Anti-CD81 antibody [QV-6A8-S3] (ab180771)
Key features and details
- Rat monoclonal [QV-6A8-S3] to CD81
- Suitable for: Flow Cyt
- Reacts with: Camel
- Isotype: IgG2b
Overview
-
Product name
Anti-CD81 antibody [QV-6A8-S3]
See all CD81 primary antibodies -
Description
Rat monoclonal [QV-6A8-S3] to CD81 -
Host species
Rat -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Camel -
Immunogen
Other Immunogen Type corresponding to Human CD81 aa 1-236. genetic immunisation with cDNA encoding human CD81
Sequence:MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELG DKPAPNTFYV GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCL VILFACEVAAGIWGFVNKDQIA KDVKQFYDQALQQAVVDDDANNAKAV VKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSN IISNLFKEDCHQKI DDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
Database link: P60033 -
Positive control
- Dubca cells transiently transfected with an expression vector encoding CD81/TAPA1.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
QV-6A8-S3 -
Isotype
IgG2b -
Research areas