Anti-CD3D antibody (ab103573)
Key features and details
- Rabbit polyclonal to CD3D
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-CD3D antibody
See all CD3D primary antibodies -
Description
Rabbit polyclonal to CD3D -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Full length protein corresponding to Human CD3D aa 1-171.
Sequence:MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGT LLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELD PATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQ PLRDRDDAQYSHLGGNWARNK
Database link: P04234 -
Positive control
- Mouse kidney tissue lysate, CD3D transfected 293T cell line lysate, HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 2.68% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-CD3D antibody (ab103573) at 1/500 dilution + Mouse Kidney tissue lysate at 50 µg
Predicted band size: 19 kDa
-
All lanes : Anti-CD3D antibody (ab103573) at 1/500 dilution
Lane 1 : CD20 transfected 293T cell line lysate
Lane 2 : Non-transfected 293T cell line lysate
Lysates/proteins at 25 µg per lane.
Predicted band size: 19 kDa
-
Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX.
ab103573 at 1/1200 staining CDED in HeLa cells with anti-CANX mouse monoclonal antibody 1/50. Signals were detected by Duolink® 30 Detection Kit 613(red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.

