Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Adaptive Immunity T Cells CD

Anti-CD3D antibody (ab103573)

Anti-CD3D antibody (ab103573)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to CD3D
  • Suitable for: WB, ICC/IF
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
FITC Anti-CD83 antibody [Michel-19] (ab48318)
Product image
Anti-CD10 antibody [EPR22867-118] (ab256494)
Product image
PE Anti-CD19 antibody [LT19], prediluted (ab18229)
Product image
Alexa Fluor® 488 Anti-CD4 antibody [EPR20122] (ab252149)

Overview

  • Product name

    Anti-CD3D antibody
    See all CD3D primary antibodies
  • Description

    Rabbit polyclonal to CD3D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Full length protein corresponding to Human CD3D aa 1-171.
    Sequence:

    MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGT LLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELD PATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQ PLRDRDDAQYSHLGGNWARNK


    Database link: P04234
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Mouse kidney tissue lysate, CD3D transfected 293T cell line lysate, HeLa cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Constituent: 2.68% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Adaptive Immunity
    • B Cells
    • CD
    • Immunology
    • Adaptive Immunity
    • T Cells
    • CD
    • Stem Cells
    • Hematopoietic Progenitors
    • Hematopoietic Stem Cells
    • Human Lineage Negative
    • Cancer
    • Tumor immunology
    • Tumor-associated antigens

Images

  • Western blot - Anti-CD3D antibody (ab103573)
    Western blot - Anti-CD3D antibody (ab103573)
    Anti-CD3D antibody (ab103573) at 1/500 dilution + Mouse Kidney tissue lysate at 50 µg

    Predicted band size: 19 kDa

  • Western blot - Anti-CD3D antibody (ab103573)
    Western blot - Anti-CD3D antibody (ab103573)
    All lanes : Anti-CD3D antibody (ab103573) at 1/500 dilution

    Lane 1 : CD20 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 25 µg per lane.

    Predicted band size: 19 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-CD3D antibody (ab103573)
    Immunocytochemistry/ Immunofluorescence - Anti-CD3D antibody (ab103573)

    Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX.
    ab103573 at 1/1200 staining CDED in HeLa cells with anti-CANX mouse monoclonal antibody 1/50. Signals were detected by Duolink® 30 Detection Kit 613(red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-CD3D antibody (ab103573)

  •  
  • Product image

    Anti-CD3D antibody [EP4426] - Low endotoxin, Azide free (ab215040)

    Applications: ICC, IHC-P, IP, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-CD3D antibody [EP4426] (ab198935)

    Applications: ICC/IF

  •  
  • Product image

    Alexa Fluor® 555 Anti-CD3D antibody [EP4426] (ab208514)

    Applications: ICC/IF

  •  
  • Product image

    Anti-CD3D antibody (ab226246)

    Applications: IP, WB

  •  
  • Product image

    Anti-CD3D antibody [EPR20544] (ab213362)

    Applications: Flow Cyt, IHC-Fr, IHC-P, IP, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-CD3D antibody [EP4426] (ab198937)

    Applications: ICC/IF

  •  
  • Product image

    Anti-CD3D antibody [EP4426] (ab109531)

    Applications: ICC/IF, IHC-P, IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Human ECM1 ELISA Kit (ab246524)

  •  
  • Recombinant Human IL-17A protein (ab166882)

  •  
  • Mouse liver tissue lysate - total protein (ab29301)

  •  
  • Product image

    Recombinant Human IP10 protein (ab269210)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.