Anti-CD39 antibody [IMG17B5F11] (ab178572)
Key features and details
- Mouse monoclonal [IMG17B5F11] to CD39
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-CD39 antibody [IMG17B5F11]
See all CD39 primary antibodies -
Description
Mouse monoclonal [IMG17B5F11] to CD39 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human CD39 aa 102-208.
Sequence:GIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDV VERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPY ETNNQET
Database link: P49961 -
Positive control
- Human, mouse and rat brain lysates; Human spleen tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.05% Sodium azide
Constituents: 0.05% BSA, 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
IMG17B5F11 -
Isotype
IgG2b -
Light chain type
lambda -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD39 antibody [IMG17B5F11] (ab178572)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded normal Human spleen tissue labeling CD39 with ab178572 at 5 µg/ml, followed by peroxidase-conjugate and DAB chromogen.
-
All lanes : Anti-CD39 antibody [IMG17B5F11] (ab178572) at 1 µg/ml
Lane 1 : Human brain lysate
Lane 2 : Mouse brain lysate
Lane 3 : Rat brain lysate
Lane 4 : Recombinant Human CD39 protein fragment
Predicted band size: 58 kDa