Anti-CD14 antibody [1H5D8] (ab181470)
![Anti-CD14 antibody [1H5D8] (ab181470)](https://www.abcam.com/ps/products/181/ab181470/Images/ab181470-210660-anti-cd14-antibody-1h5d8-immunohistochemistry.jpg "Anti-CD14 antibody [1H5D8] (ab181470)")
Key features and details
- Mouse monoclonal [1H5D8] to CD14
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-CD14 antibody [1H5D8]
See all CD14 primary antibodies -
Description
Mouse monoclonal [1H5D8] to CD14 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P HumanWB Human
-
Immunogen
Recombinant fragment corresponding to Human CD14 aa 20-214. (Expressed in E.coli).
Sequence:TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPF LKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLK ELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMA
Database link: P08571 -
Positive control
- WB: Human CD14 (aa 20-214) recombinant protein; CD14 (aa 20-214)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human cervical cancer and colon tissues. ICC/IF: HepG2 cells.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR281538-10 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS
Contains 0.5% protein stabilizer. -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1H5D8 -
Isotype
IgG2a -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
Immunohistochemical analysis of paraffin-embedded human colon tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
![Western blot - Anti-CD14 antibody [1H5D8] (ab181470)](https://www.abcam.com/ps/products/181/ab181470/Images/ab181470-210658-anti-cd14-antibody-1h5d8-western-blot.jpg)
Western blot - Anti-CD14 antibody [1H5D8] (ab181470)All lanes : Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution
Lane 1 : Non-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Lane 2 : CD14 (aa 20-214)-hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Predicted band size: 40 kDa
-
![Immunocytochemistry/ Immunofluorescence - Anti-CD14 antibody [1H5D8] (ab181470)](https://www.abcam.com/ps/products/181/ab181470/Images/ab181470-210662-anti-cd14-antibody-1h5d8-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-CD14 antibody [1H5D8] (ab181470)Immunofluorescent analysis of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling CD14 with ab181470 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)](https://www.abcam.com/ps/products/181/ab181470/Images/ab181470-210659-anti-cd14-antibody-1h5d8-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
![Western blot - Anti-CD14 antibody [1H5D8] (ab181470)](https://www.abcam.com/ps/products/181/ab181470/Images/ab181470-210657-anti-cd14-antibody-1h5d8-western-blot.jpg)
Western blot - Anti-CD14 antibody [1H5D8] (ab181470)Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution + Human CD14 (aa 20-214) recombinant protein
Predicted band size: 40 kDaExpected MWt is 46.8 kDa.
