Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Transcription Co-factors

Anti-cbx7 antibody (ab91431)

Anti-cbx7 antibody (ab91431)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to cbx7
  • Suitable for: IHC-P, WB, IP
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-TAF5 antibody [EPR15433] - C-terminal (ab195236)
Product image
Anti-TAF5 antibody (ab251684)
Product image
Anti-cbx7 antibody [EPR12630] - BSA and Azide free (ab250037)
Product image
Anti-TAF5 antibody (ab235333)

Overview

  • Product name

    Anti-cbx7 antibody
    See all cbx7 primary antibodies
  • Description

    Rabbit polyclonal to cbx7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human cbx7 aa 201-251. The exact sequence is proprietary.
    Sequence:

    DADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGK F


    Database link: O95931
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa or 293T cell lysate
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 6.8
    Preservative: 0.09% Sodium azide
    Constituents: Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antibody was affinity purified using an epitope specific to cbx7 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Co-factors
    • Epigenetics and Nuclear Signaling
    • Chromatin Remodeling
    • Polycomb Silencing
    • Other

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-cbx7 antibody (ab91431)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-cbx7 antibody (ab91431)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung carcinoma tissue labelling cbx7 with ab91431 at 1/200 (1µg/ml). Detection: DAB.
  • Western blot - Anti-cbx7 antibody (ab91431)
    Western blot - Anti-cbx7 antibody (ab91431)
    All lanes : Anti-cbx7 antibody (ab91431) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 28 kDa


    Exposure time: 10 seconds
  • Immunoprecipitation - Anti-cbx7 antibody (ab91431)
    Immunoprecipitation - Anti-cbx7 antibody (ab91431)
    cbx7 was immunoprecipitated from HeLa whole cell lysate, using ab91431 at 10 µg/mg of lysate. 20% of the immunoprecipitae was loaded per lane for the subsequent Western blot and probed with ab91431 at 1 µg/ml (lane 1) or a control IgG (lane 2).
    Detetion: chemoluminescence with exposure time of 30 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-cbx7 antibody (ab91431)

  •  
  • Product image

    Anti-cbx7 antibody (ab21873)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-cbx7 antibody [EPR12630] (ab178411)

    Applications: Flow Cyt, WB

  •  
  • Product image

    Anti-cbx7 antibody (ab123492)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-GAPDS antibody (ab153802)

  •  
  • Product image

    Anti-EXOC8 antibody (ab254804)

  •  
  • Product image

    Anti-Dio3 antibody (ab234770)

  •  
  • Product image

    Anti-ADAM30 antibody (ab90504)

  •  
  • Product image

    Recombinant Human DLL3 protein (Tagged) (ab226231)

  •  
  • Product image

    Recombinant Human AKR1C4 protein (ab172176)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.