Anti-cbx7 antibody (ab91431)
Key features and details
- Rabbit polyclonal to cbx7
- Suitable for: IHC-P, WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-cbx7 antibody
See all cbx7 primary antibodies -
Description
Rabbit polyclonal to cbx7 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Horse, Cow, Chimpanzee, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human cbx7 aa 201-251. The exact sequence is proprietary.
Sequence:DADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGK F
Database link: O95931 -
Positive control
- HeLa or 293T cell lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: Tris buffered saline, 0.1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antibody was affinity purified using an epitope specific to cbx7 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung carcinoma tissue labelling cbx7 with ab91431 at 1/200 (1µg/ml). Detection: DAB.
-
All lanes : Anti-cbx7 antibody (ab91431) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 28 kDa
Exposure time: 10 seconds
-
cbx7 was immunoprecipitated from HeLa whole cell lysate, using ab91431 at 10 µg/mg of lysate. 20% of the immunoprecipitae was loaded per lane for the subsequent Western blot and probed with ab91431 at 1 µg/ml (lane 1) or a control IgG (lane 2).
Detetion: chemoluminescence with exposure time of 30 seconds.