Anti-Cathepsin K antibody [3F9] (ab37259)
Key features and details
- Mouse monoclonal [3F9] to Cathepsin K
- Suitable for: WB, IHC-P, Flow Cyt
- Reacts with: Mouse, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Cathepsin K antibody [3F9]
See all Cathepsin K primary antibodies -
Description
Mouse monoclonal [3F9] to Cathepsin K -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanWB Human -
Immunogen
Recombinant fusion protein, corresponding to amino acids 115-329 of Human Cathepsin K. The protein contains at the N-terninal end a His tag (6x) and 6 additional amino acid residues (MRGSHHHHHHGS).
-
Epitope
The monoclonal antibody ab37259 (clone 3F9) reacts with an epitope located between aa 115-329: APDSVDYRKKGYVTPNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGC GGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRA VARVGPVSVAIDASLTSFQFSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE NWGNKGYILMARNKNNACGIANLASFPKM -
General notes
This product was changed from ascites to tissue culture supernatant on 22nd December 2017. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. -
Storage buffer
Constituents: 0.58% Sodium chloride, 0.134% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
3F9 -
Isotype
IgG2b -
Research areas
Images
-
Bone from mouse foot (bone marrow with osteoclasts (positive). IHC-P image was obtained after deparaffinization, antigen retrieval with 0.1 M EDTA (6-8 min, 72 C), drying of slide before staining (10 min, 62 C), and subsequent staining with primary antibody (1/100) in 1% horse serum (1 h, 37 C).
-
Anti-Cathepsin K antibody [3F9] (ab37259) at 1 µg/ml + Human bone tumor tissue lysate - total protein (ab29359) at 10 µg
Secondary
Goat polyclonal Secondary Antibody to Mouse IgG - H&L (HRP), pre-adsorbed at 1/3000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 37 kDa
Observed band size: 37 + 40 kDa why is the actual band size different from the predicted?
Additional bands at: 26 kDa (possible cleavage fragment)
Exposure time: 1 minute
Cathepsin K contains a potential glycosylation site (SwissProt) which may explain its migration at a higher molecular weight than predicted, seen at 40 kDa. The band observed at 25 kDa could potentially be a cleaved form of Cathepsin K due to the presence of both a 15 amino acid signal prptide and a 99 amino acid propeptide. Cathepsin K in its mature form has an expected molecular weight of 25 kDa. -
Overlay histogram showing U20S cells stained with ab37259 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab37259, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in U20S cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.