Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway Nuclear Signaling Nuclear Hormone Receptors Estrogen

Anti-C1orf77/FOP antibody (ab176719)

Anti-C1orf77/FOP antibody (ab176719)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to C1orf77/FOP
  • Suitable for: WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Estrogen Receptor alpha antibody [CRET94D] (ab241557)
Product image
Anti-Estrogen Receptor alpha antibody [ESR1/3557] - BSA and Azide free (ab259430)
Product image
PE Anti-Estrogen Receptor alpha antibody [E115] (ab209288)
Product image
Anti-Estrogen Receptor alpha antibody [CRET94D] - BSA and Azide free (ab252794)

Overview

  • Product name

    Anti-C1orf77/FOP antibody
    See all C1orf77/FOP primary antibodies
  • Description

    Rabbit polyclonal to C1orf77/FOP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Synthetic peptide within Human C1orf77/FOP aa 198-248. The exact sequence is proprietary. (NP_056422.2).
    Sequence:

    GRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETN D


    Database link: Q9Y3Y2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Jurkat, 293T and HeLa whole cell lysates.
  • General notes

     This product was previously labelled as C1orf77, Fop

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176719 was affinity purified using an epitope specific to C1orf77/FOP immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • Nuclear Hormone Receptors
    • Estrogen
    • Epigenetics and Nuclear Signaling
    • Nuclear Signaling Pathways
    • Nuclear Receptors
    • Estrogen

Images

  • Western blot - Anti-C1orf77/FOP antibody (ab176719)
    Western blot - Anti-C1orf77/FOP antibody (ab176719)
    All lanes : Anti-C1orf77/FOP antibody (ab176719) at 0.1 µg/ml

    Lane 1 : Jurkat whole cell lysate at 50 µg
    Lane 2 : Jurkat whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : HeLa whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 26 kDa


    Exposure time: 3 minutes

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-C1orf77/FOP antibody (ab176719)

  •  
  • Product image

    Anti-C1orf77/FOP antibody (ab123603)

    Applications: WB

  •  
  • Product image

    Anti-C1orf77/FOP antibody (ab220086)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-C1orf77/FOP antibody (ab222861)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CLEC2D antibody [EPR6584(2)] (ab151738)

  •  
  • Product image

    Anti-RBMS1 antibody [EPR9825(B)] (ab150353)

  •  
  • Product image

    Anti-Inhibin alpha antibody [4A2F2] (ab47720)

  •  
  • Product image

    Anti-Ornithine Decarboxylase/ODC antibody (ab66067)

  •  
  • Product image

    Anti-Thymidine Phosphorylase antibody - N-terminal (ab180783)

  •  
  • Product image

    Anti-CD130 (gp130) antibody - C-terminal (ab226346)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.