Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Regulators

Anti-beta Arrestin 1 antibody (ab175266)

Anti-beta Arrestin 1 antibody (ab175266)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to beta Arrestin 1
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-FAM13A antibody (ab122440)
Product image
Anti-IPCEF1 antibody - BSA and Azide free (Capture) (ab242602)
Product image
Anti-DOCK6 antibody (ab188445)
Product image
Anti-Beta Arrestin 2 antibody (ab54790)

Overview

  • Product name

    Anti-beta Arrestin 1 antibody
    See all beta Arrestin 1 primary antibodies
  • Description

    Rabbit polyclonal to beta Arrestin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human beta Arrestin 1 aa 1-418.
    Sequence:

    MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKE RRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL QERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFC AENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLE ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYK CPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFT LMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMK DDKEEEEDGTGSPQLNNR


    Database link: P49407
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Lung tissue lysate.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • Heterotrimeric G Proteins
    • Regulators
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • GPCR
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Other
    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • Tyrosine Kinase Receptors

Images

  • Western blot - Anti-beta Arrestin 1 antibody (ab175266)
    Western blot - Anti-beta Arrestin 1 antibody (ab175266)
    Anti-beta Arrestin 1 antibody (ab175266) at 1/500 dilution + lung tissue lysate

    Predicted band size: 47 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Arrestin 1 antibody (ab175266)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Arrestin 1 antibody (ab175266)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat lung tissue labelling beta Arrestin 1 with ab175266 at 1/100. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Arrestin 1 antibody (ab175266)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Arrestin 1 antibody (ab175266)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse testis tissue labelling beta Arrestin 1 with ab175266 at 1/100. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Arrestin 1 antibody (ab175266)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Arrestin 1 antibody (ab175266)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer tissue labelling beta Arrestin 1 with ab175266 at 1/100. Magnification: 200x.
  • Immunocytochemistry/ Immunofluorescence - Anti-beta Arrestin 1 antibody (ab175266)
    Immunocytochemistry/ Immunofluorescence - Anti-beta Arrestin 1 antibody (ab175266)
    Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175266. Blue DAPI for nuclear staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-beta Arrestin 1 antibody (ab175266)

  •  
  • Product image

    Anti-beta Arrestin 1 antibody (ab31868)

    Applications: ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-beta Arrestin 1 (phospho S412) antibody [E109] (ab32097)

    Applications: Dot, IHC-P, WB

  •  
  • Product image

    Anti-beta Arrestin 1 antibody [E274] (ab32099)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-beta Arrestin 1 antibody [E274] (ab199090)

    Applications: ICC/IF

  •  
  • Product image

    Anti-beta Arrestin 1 antibody [E274] - BSA and Azide free (ab206776)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-beta Arrestin 1 antibody [E274] (ab199499)

    Applications: ICC/IF

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.