Anti-FAM13A antibody (ab122440)
Key features and details
- Rabbit polyclonal to FAM13A
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FAM13A antibody
See all FAM13A primary antibodies -
Description
Rabbit polyclonal to FAM13A -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FAM13A aa 904-973 (C terminal).
Sequence:TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLE HLQEMREEKKRIRKKLRDFE
Database link: O94988 -
Positive control
- IHC-P: Human testis, small intestine, Fallopian tube and cerebral cortex Tissue ICC/IF: Human cell line U-2 OS
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human small intestine labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells.
-
Immunocytochemistry/ Immunofluorescence analysis of U2-OS cells labeling FAM13A with ab122440 showing localization to nucleoli, cytosol & cell junctions.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human fallopian tube labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human cerebral cortex labeling FAM13A with ab122440 showing strong cytoplasmic positivity in neurons.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human testis labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells in seminiferous duct.