Amylin (rat), Endogenous peptide (ab142399)
Key features and details
- Endogenous peptide secreted by pancreatic β-cells
- CAS Number:
- Purity: > 95%
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Amylin (rat), Endogenous peptide -
Description
Endogenous peptide secreted by pancreatic β-cells -
Biological description
Endogenous peptide secreted by pancreatic β-cells. Potently activates amylin, calcitonin (EC50 = 0.67 nM), CGRP and adrenomedullin receptors. Potently inhibits insulin-stimulated glucose uptake (IC50 = 12 pM). Implicated in type II diabetes. Active in vivo. Human (ab142398) and feline (ab142397) amylin also available. -
Purity
> 95% -
Chemical structure

Properties
-
Molecular weight
3918.47 -
Molecular formula
C167H272N52O53S2 -
Sequence
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY (Modifications: C-terminal amide; Disulfide bonds: 2-7) -
Storage instructions
Store at +4°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas