Synthetic Human C5a protein (ab176089)
Key features and details
- Expression system: Synthetic
- Suitable for: HPLC
-
Product name
Synthetic Human C5a protein
See all C5a proteins and peptides -
Expression system
Synthetic -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Synthetic -
-
Species
Human -
Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKA FTECCVVASQLRANISHKDMQLGR -
Predicted molecular weight
9 kDa -
Amino acids
678 to 751 -
Additional sequence information
Sequence refers to C5a anaphylatoxin chain.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: Water
Lyophilized from water/acetonitrile/TFA to generate the TFA salt form. -
ReconstitutionIt is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.