Recombinant rat CX3CL1 protein (ab201406)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant rat CX3CL1 protein
See all CX3CL1 proteins and peptides -
Biological activity
Fully biologically active when compared to standard.
The biological activity determined by a chemotaxis bioassay using Human monocytes is in a concentration of 5.0-10 ng/ml.
-
Purity
> 95 % SDS-PAGE.
>95% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFC ADPKEKWVQDAMKHLDHQTAALTRNG -
Predicted molecular weight
9 kDa -
Amino acids
25 to 100 -
Additional sequence information
Single non-glycosylated polypeptide chain.
-
Preparation and Storage
-
Alternative names
- A 152E5.2
- AB030188
- ABCD 3
see all -
Function
The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. -
Tissue specificity
Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. -
Sequence similarities
Belongs to the intercrine delta family. -
Post-translational
modificationsA soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.
O-glycosylated with core 1 or possibly core 8 glycans. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
