Recombinant Protein G (ab73758)
Key features and details
- Expression system: Escherichia coli
- Suitable for: ELISA, SDS-PAGE
-
Product name
Recombinant Protein G
See all Protein G proteins and peptides -
Expression system
Escherichia coli -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
HIV-1 -
Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKV FK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKT L KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE -
Predicted molecular weight
22 kDa -
Amino acids
190 to 384 -
Additional sequence information
Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present.
-
Preparation and Storage
-
Alternative names
- IgG binding protein G
- IgG-binding protein G
- Immunoglobulin G binding protein G [Precursor]
see all -
Relevance
Protein G is a bacterial protein derived from the cell wall of certain strains of b-hemolytic Streptococcci. It binds with high affinity to the Fc portion of various classes and subclasses of immunoglobulins from a variety of species. Protein G binds to all IgG subclasses from human, mouse and rat species. It also binds to total IgG from guinea pig, rabbit, goat, cow, sheep, and horse. Protein G binds preferentially to the Fc portion of IgG, but can also bind to the Fab region, making it useful for purification of F(ab') fragments of IgG. Due to it's affinity for the Fc region of many mammalian immunoglobulins, protein G is considered a universal reagent in biochemistry and immunology. -
Cellular localization
Cell Wall and Secreted
