Recombinant Mouse ST2 protein (Fc Chimera) (ab214561)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse ST2 protein (Fc Chimera)
See all ST2 proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
SKSSWGLENEALIVRCPQRGRSTYPVEWYYSDTNESIPTQKRNRIFVSRD RLKFLPARVEDSGIYACVIRSPNLNKTGYLNVTIHKKPPSCNIPDYLMYS TVRGSDKNFKITCPTIDLYNWTAPVQWFKNCKALQEPRFRAHRSYLFIDN VTHDDEGDYTCQFTHAENGTNYIVTATRSFTVEEKGFSMFPVITNPPYNH TMEVEIGKPASIACSACFGKGSHFLADVLWQINKTVVGNFGEARIQEEEG RNESSSNDMDCLTSVLRITGVTEKDLSLEYDCLALNLHGMIRHTIRLRRK QPIDHRSIYYIVAGCS -
Amino acids
27 to 342 -
Additional sequence information
The extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab214561 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
-
ReconstitutionReconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- DER-4
- DER4
- FIT 1
see all -
Function
Receptor for interleukin-33 (IL-33), its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function. -
Tissue specificity
Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C is not detected in brain, heart, liver, kidney and skeletal muscle. -
Sequence similarities
Belongs to the interleukin-1 receptor family.
Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 TIR domain. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214561 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- DER-4
- DER4
- FIT 1
see all -
Function
Receptor for interleukin-33 (IL-33), its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function. -
Tissue specificity
Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C is not detected in brain, heart, liver, kidney and skeletal muscle. -
Sequence similarities
Belongs to the interleukin-1 receptor family.
Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 TIR domain. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt