Recombinant mouse CCL25 protein (ab201368)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant mouse CCL25 protein
See all CCL25 proteins and peptides -
Biological activity
Fully biologically active when compared to standard.
The ED50 determined by a chemotaxis bioassay using Human CCR9 transfected BaF3 murine proB cells is less than 500 ng/ml, corresponding to a specific activity of >2×103 IU/mg.
-
Purity
> 95 % SDS-PAGE.
>95% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVC GNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNST SVRSATLGHPRMVMMPRKTNN -
Predicted molecular weight
14 kDa -
Amino acids
24 to 144 -
Additional sequence information
Single, non-glycosylated polypeptide chain. This product is the mature full length protein from aa 24 to 144. The signal peptide is not included.
-
Preparation and Storage
-
Alternative names
- A130072A22Rik
- C-C motif chemokine 25
- CCL 25
see all -
Function
Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. -
Tissue specificity
Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
