Recombinant human VEGFE protein (ab53679)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human VEGFE protein
See all VEGFE proteins and peptides -
Biological activity
The ED50 for stimulation of 3H-thymidine incorporation and cell proliferation by human umbilical vein endothelial cells for VEGFE has been determined to be in the range of 5 - 20 ng/ml. Specific activity: 2 x 105 units/mg.
-
Purity
> 90 % SDS-PAGE.
Purity: > 90%, by SDS-PAGE and visualised by silver stain. Endotoxin level: -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHDSTKTWSEVFENSGCKPRPMVFRVHDEHPE LTSQRFNPPCVTLMRCGGCCNDESLECVPTEEANVTMQLMGASVSGGNGM QHLSFVEHKKCDCKPPLTTTPPTTTRPPRRRR -
Amino acids
21 to 81 -
Tags
His tag N-Terminus -
Additional sequence information
Recombinant VEGFE with an N-terminal His-tag sequence and a thrombin cleavage site. GenBank accession No. AF106020.
-
Preparation and Storage
-
Relevance
Based on sequence similarity to VEGFA, a gene encoding a VEGF homologue has recently been discovered in the genome of Orf virus (OV) (Lyttle et al., 1994). Different isolates of Orf virus show significant amino acid sequence similarity to VEGFA and described as a viral virulence factor that appears to be derived from captured host genes. All eight cysteine residues of the central cysteine knot motif characteristic of members of the VEGF family are conserved among other residues in the VEGFE proteins (Dehio et al., 1999; Wise et al., 1999). Alignment of all mammalian VEGF sequences indicated that VEGFE is distinct from the previously described VEGFs but most closely related to VEGFA.
Images
-
SDS-PAGE - Recombinant human VEGFE protein (ab53679)SDS-PAGE analysis of recombinant ov-VEGF-E. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.
-
Functional Studies - Recombinant human VEGFE protein (ab53679)Stimulation of cell proliferation in primary human umbilical vein endothelial cells (HUVEC) by recombinant ov-VEGF-E and ov-HB-VEGF-E. Values are the means (±SD) of triplicate determinations and expressed as percentage of control.