Recombinant Human VE Cadherin protein (ab112269)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, PepArr, WB, ELISA
-
Product name
Recombinant Human VE Cadherin protein
See all VE Cadherin proteins and peptides -
Biological activity
useful for Antibody Production and Protein Array -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETG DVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV -
Predicted molecular weight
37 kDa including tags -
Amino acids
51 to 150 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- 7B 4
- 7B4
- 7B4 antigen
see all -
Function
Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton. -
Tissue specificity
Endothelial tissues and brain. -
Sequence similarities
Contains 5 cadherin domains. -
Post-translational
modificationsPhosphorylated on tyrosine residues by KDR/VEGFR-2. Dephosphorylated by PTPRB. -
Cellular localization
Cell junction. Cell membrane. Found at cell-cell boundaries and probably at cell-matrix boundaries. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human VE Cadherin protein (ab112269)12.5% SDS-PAGE Stained with Coomassie Blue.
