Recombinant Human Uteroglobin protein (ab176042)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human Uteroglobin protein
See all Uteroglobin proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP QKPRESIIKLMEKIAQSSLCN -
Predicted molecular weight
8 kDa -
Amino acids
22 to 91 -
Additional sequence information
(Homodimeric protein consisting of 142 amino acid residues).
Associated products
Specifications
Our Abpromise guarantee covers the use of ab176042 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 100% PBS
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20oC to -80oC
General Info
-
Alternative names
- Blastokinin
- CC10
- CC16
see all -
Function
Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2. -
Tissue specificity
Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways). -
Sequence similarities
Belongs to the secretoglobin family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab176042 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- Blastokinin
- CC10
- CC16
see all -
Function
Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2. -
Tissue specificity
Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways). -
Sequence similarities
Belongs to the secretoglobin family. -
Cellular localization
Secreted. - Information by UniProt