Recombinant Human TREML2 protein (ab191918)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: HPLC, SDS-PAGE
-
Product name
Recombinant Human TREML2 protein
See all TREML2 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
GPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFA RVWVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMG FQLDVSPAPQSERNIPFTHLDNILKSGTVTTGQAPTSGPDAPFTTGVMVF TPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQTVTASPSNA RDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYS VDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK -
Predicted molecular weight
54 kDa including tags -
Amino acids
19 to 268 -
Additional sequence information
Extracellular domain fused with a FC tag at the C-terminus.
Specifications
Our Abpromise guarantee covers the use of ab191918 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 µM filtered solution.
General Info
-
Alternative names
- C6orf76
- Chromosome 6 open reading frame 76
- FLJ13693
see all -
Relevance
TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. It is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties. TREML2 is expressed throughout B cell development in addition to being expressed on macrophages and neutrophils and is the only TREM molecule to be found on lymphocytes. TREML2 is expressed on B lineage cells early in development, and the highest level of expression is detected on those mature peripheral B cell subpopulations that are involved in the initial humoral immune response against bacterial pathogens. TREML2 is unique in that it lacks either the conserved transmembrane lysine residue or ITAM/ITIMs within its own cytoplasmic domain. Thus, TREML2 does not exhibit any of the features associated with classical tyrosine-based signaling. Monocytes in the bone marrow or peripheral blood do not express detectable levels of TREML2, but its expression is up-regulated in conjunction with differentiation into macrophages. TREML2 is present on neutrophils in the bone marrow as well as the periphery, and inflammatory stimuli result in a dramatic increase in the expression of TREML2 on these cells in vivo. -
Cellular localization
Cell membrane; Single-pass type I membrane protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab191918 has not yet been referenced specifically in any publications.
Preparation and Storage
- C6orf76
- Chromosome 6 open reading frame 76
- FLJ13693