Recombinant human Thymosin beta 4 protein (Active) (ab245823)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
-
Product name
Recombinant human Thymosin beta 4 protein (Active)
See all Thymosin beta 4 proteins and peptides -
Biological activity
Pretreatment of primary lung fibroblasts with recombinant Thymosin-β4, using a concentration of 0.5 - 10 μg/ml, produces a protective effect against hydrogen peroxide induced cell death.
-
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
RMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES -
Predicted molecular weight
5 kDa -
Amino acids
1 to 44
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab245823 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Additional notes
Human, mouse and rat Thymosin beta 4 proteins are identical in sequence.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in water to 0.1 - 1.0 mg/ml.
General Info
-
Alternative names
- Fx
- Hematopoietic system regulatory peptide
- Prothymosin beta 4
see all -
Function
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Seraspenide inhibits the entry of hematopoeitic pluripotent stem cells into the S-phase. -
Tissue specificity
Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells. -
Sequence similarities
Belongs to the thymosin beta family. -
Cellular localization
Cytoplasm > cytoskeleton. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab245823 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in water to 0.1 - 1.0 mg/ml.