Recombinant human TGF beta 1 protein (Animal Free) (ab217396)
Key features and details
- Expression system: CHO cells
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
-
Product name
Recombinant human TGF beta 1 protein (Animal Free)
See all TGF beta 1 proteins and peptides -
Biological activity
Determined by TGF beta 1’s ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The expected ED50 is ≤ 0.05 ng/mL, corresponding to a specific activity of ≥ 2 x 107 units/mg.
-
Purity
> 98 % SDS-PAGE.
> 98% by HPLC analysis. -
Expression system
CHO cells -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS -
Predicted molecular weight
25 kDa -
Amino acids
279 to 390 -
Additional sequence information
Two identical 112 amino acid polypeptide chains linked by a single disulfide bond.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
