Recombinant Human TCR V delta 1 protein (ab159659)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
-
Product name
Recombinant Human TCR V delta 1 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHST DFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR -
Amino acids
173 to 272 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- T cell antigen receptor delta polypeptide
- T cell receptor delta (V,D,J,C)
- T cell receptor delta locus
see all -
Relevance
Two distinct types of T cell antigen receptors have been identified: the alpha/beta heterodimer found on functional helper and cytotoxic T cells, and the gamma/delta heterodimer. The latter is first detected approximately 2 days before the appearance of cell surface alpha/beta heterodimer during T cell ontogeny. In adult thymus it is found mainly in the least mature cells. The gene shows systematic rearrangement in early thymocytes and appears to use V gene segments of the TCR alpha chain family, well before any C(alpha) message of protein is detected. RNA from this locus is expressed at a high level in early thymocytes and adult 'double-negative' cells, but not in mature T cell populations.