Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Neurology process Neurodegenerative disease Alzheimer's disease Tangles & Tau

Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)

Price and availability

432 201 ₸

Availability

Order now and get it on Thursday February 25, 2021

Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% Ion Exchange Chromatography
  • Active: Yes
  • Suitable for: Electron Microscopy, Functional Studies, SDS-PAGE

You may also be interested in

Product image
Anti-Prealbumin antibody (ab231657)
Product image
Recombinant Mouse Prealbumin protein (Tagged) (ab236177)
Product image
Recombinant Human Tau (mutated R406W) protein (ab269009)
Product image
Recombinant Human Tau441 protein (ab167949)

Description

  • Product name

    Recombinant human Tau (mutated P301S) protein aggregate (Active)
    See all Tau proteins and peptides
  • Biological activity

    Thioflavin T emission curve shows increased fluorescence (correlated to tau protein fibrillation) when ab246003 is combined with active tau monomers.

  • Purity

    > 95 % Ion Exchange Chromatography.

  • Expression system

    Escherichia coli
  • Accession

    P10636
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG TTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTK IATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPM PDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV SGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRV QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS GDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
    • Predicted molecular weight

      46 kDa
    • Amino acids

      1 to 441
    • Modifications

      mutated P301S
    • Additional sequence information

      NP_005901.2
  • Description

    Recombinant human Tau (mutated P301S) protein (Active)

Preparation and Storage

  • Alternative names

    • AI413597
    • AW045860
    • DDPAC
    • FLJ31424
    • FTDP 17
    • G protein beta1/gamma2 subunit interacting factor 1
    • MAPT
    • MAPTL
    • MGC134287
    • MGC138549
    • MGC156663
    • Microtubule associated protein tau
    • Microtubule associated protein tau isoform 4
    • Microtubule-associated protein tau
    • MSTD
    • Mtapt
    • MTBT1
    • MTBT2
    • Neurofibrillary tangle protein
    • Paired helical filament tau
    • Paired helical filament-tau
    • PHF tau
    • PHF-tau
    • PPND
    • PPP1R103
    • Protein phosphatase 1, regulatory subunit 103
    • pTau
    • RNPTAU
    • TAU
    • TAU_HUMAN
    • Tauopathy and respiratory failure
    • Tauopathy and respiratory failure, included
    see all
  • Function

    Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
  • Tissue specificity

    Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system.
  • Involvement in disease

    Note=In Alzheimer disease, the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments (PHF) and straight filaments, mainly composed of hyperphosphorylated forms of TAU (PHF-TAU or AD P-TAU).
    Defects in MAPT are a cause of frontotemporal dementia (FTD) [MIM:600274]; also called frontotemporal dementia (FTD), pallido-ponto-nigral degeneration (PPND) or historically termed Pick complex. This form of frontotemporal dementia is characterized by presenile dementia with behavioral changes, deterioration of cognitive capacities and loss of memory. In some cases, parkinsonian symptoms are prominent. Neuropathological changes include frontotemporal atrophy often associated with atrophy of the basal ganglia, substantia nigra, amygdala. In most cases, protein tau deposits are found in glial cells and/or neurons.
    Defects in MAPT are a cause of Pick disease of the brain (PIDB) [MIM:172700]. It is a rare form of dementia pathologically defined by severe atrophy, neuronal loss and gliosis. It is characterized by the occurrence of tau-positive inclusions, swollen neurons (Pick cells) and argentophilic neuronal inclusions known as Pick bodies that disproportionally affect the frontal and temporal cortical regions. Clinical features include aphasia, apraxia, confusion, anomia, memory loss and personality deterioration.
    Note=Defects in MAPT are a cause of corticobasal degeneration (CBD). It is marked by extrapyramidal signs and apraxia and can be associated with memory loss. Neuropathologic features may overlap Alzheimer disease, progressive supranuclear palsy, and Parkinson disease.
    Defects in MAPT are a cause of progressive supranuclear palsy type 1 (PSNP1) [MIM:601104, 260540]; also abbreviated as PSP and also known as Steele-Richardson-Olszewski syndrome. PSNP1 is characterized by akinetic-rigid syndrome, supranuclear gaze palsy, pyramidal tract dysfunction, pseudobulbar signs and cognitive capacities deterioration. Neurofibrillary tangles and gliosis but no amyloid plaques are found in diseased brains. Most cases appear to be sporadic, with a significant association with a common haplotype including the MAPT gene and the flanking regions. Familial cases show an autosomal dominant pattern of transmission with incomplete penetrance; genetic analysis of a few cases showed the occurrence of tau mutations, including a deletion of Asn-613.
  • Sequence similarities

    Contains 4 Tau/MAP repeats.
  • Developmental stage

    Four-repeat (type II) tau is expressed in an adult-specific manner and is not found in fetal brain, whereas three-repeat (type I) tau is found in both adult and fetal brain.
  • Domain

    The tau/MAP repeat binds to tubulin. Type I isoforms contain 3 repeats while type II isoforms contain 4 repeats.
  • Post-translational
    modifications

    Phosphorylation at serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK: CDK1, CDK5, GSK-3, MAPK) (only 2-3 sites per protein in interphase, seven-fold increase in mitosis, and in PHF-tau), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK) in Alzheimer diseased brains. Phosphorylation decreases with age. Phosphorylation within tau's repeat domain or in flanking regions seems to reduce tau's interaction with, respectively, microtubules or plasma membrane components. Phosphorylation on Ser-610, Ser-622, Ser-641 and Ser-673 in several isoforms during mitosis.
    Polyubiquitinated. Requires functional TRAF6 and may provoke SQSTM1-dependent degradation by the proteasome (By similarity). PHF-tau can be modified by three different forms of polyubiquitination. 'Lys-48'-linked polyubiquitination is the major form, 'Lys-6'-linked and 'Lys-11'-linked polyubiquitination also occur.
    Glycation of PHF-tau, but not normal brain tau. Glycation is a non-enzymatic post-translational modification that involves a covalent linkage between a sugar and an amino group of a protein molecule forming ketoamine. Subsequent oxidation, fragmentation and/or cross-linking of ketoamine leads to the production of advanced glycation endproducts (AGES). Glycation may play a role in stabilizing PHF aggregation leading to tangle formation in AD.
  • Cellular localization

    Cytoplasm > cytosol. Cell membrane. Cytoplasm > cytoskeleton. Cell projection > axon. Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components.
  • Target information above from: UniProt accession P10636 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Electron Microscopy - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)
    Electron Microscopy - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)

    TEM of ab246003. Fibrils were sonicated and stained with uranyl acetate.

  • Electron Microscopy - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)
    Electron Microscopy - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)

    TEM of ab246003 at 150kx magnification. HV = 80kV. Fibrils were sonicated and stained with uranyl acetate.

  • Functional Studies - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)
    Functional Studies - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)

    Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) when ab246003 is combined with active tau monomers. The preformed fibrils seed the formation of new fibrils from a pool of active monomers. Thioflavin T ex = 450 nm, em = 485 nm.

  • SDS-PAGE - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)
    SDS-PAGE - Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)

    SDS-PAGE analysis of ab246003.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human Tau (mutated P301S) protein aggregate (Active) (ab246003)

  •  
  • Anti-Tau (phospho T231) antibody [EPR2488] Blocking Peptide  (ab242015)

    Applications: BL

  •  
  • Product image

    Recombinant human Tau (mutated P301S) protein (Active) (ab246005)

    Applications: FuncS, SDS-PAGE

  •  
  • Tau peptide (ab211410)

    Applications: BL

  •  
  • Product image

    Recombinant Human Tau protein (ab199583)

    Applications: HPLC, SDS-PAGE

  •  
  • Product image

    Human Tau (phospho S214) peptide (ab19123)

    Applications: BL

  •  
  • Product image

    Human Tau (unmodified ) peptide (ab23425)

    Applications: BL

  •  
  • Human Tau (phospho S396) peptide (ab226770)

    Applications: BL

Clear all

Recently viewed products

  •  
  • Goat F(ab')2 Anti-Rabbit IgG Fc (TRITC) (ab6020)

  •  
  • Product image

    Recombinant human TrkC (mutated L686M) protein (Active) (ab269084)

  •  
  • Product image

    Human Factor VII ELISA Kit (with plasma controls) (ab168545)

  •  
  • Recombinant Human PC4 (mutated S13 + S15 + S17 + S19) protein (ab81957)

  •  
  • Product image

    Recombinant Mouse SDF1 beta protein (ab256106)

  •  
  • 4-Methylumbelliferyl beta-D-N,N',N''-triacetylchitotrioside, Fluorogenic glycanase substrate (ab145023)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.