Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cancer Tumor immunology Cytokines

Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level:
  • Tags: proprietary tag C-Terminus
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Anti-c-Kit antibody, prediluted (ab16931)
Product image
Recombinant Human IL28RA protein (ab165762)
Product image
Recombinant human c-Kit (mutated V654A) protein (Active) (ab271470)
Product image
Anti-c-Kit antibody [EPR22566-344] (ab256345)

Description

  • Product name

    Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera)
    See all soluble IL2 Receptor gamma proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    HEK 293 cells
  • Accession

    P31785
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEI HLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLEL NWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFR VRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      23 to 254
    • Tags

      proprietary tag C-Terminus
    • Additional sequence information

      Fused with Fc fragment of human IgG1 at the C-terminus. Extracellular domain. The predicted N-terminus is Leu 23. DTT-reduced Protein migrates as 80-90 kDa due to glycosylation. (AAH14972)
  • Specifications

    Our Abpromise guarantee covers the use of ab174081 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Additional notes

      This product is stable after storage at:

      • -20°C to -70°C for 12 months in lyophilized state;
      • -70°C for 3 months under sterile conditions after reconstitution.
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 7.4
      Constituents: 0.75% Glycine, 0.6% Tris, 3% Trehalose

      5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    • Reconstitution
      Reconstitute with sterile deionized water to a concentration of 50 µg/ml.

    General Info

    • Alternative names

      • CD132
      • Cytokine receptor common gamma chain
      • Gamma-C
      • gammaC
      • IL-2 receptor subunit gamma
      • IL-2RG
      • IL2R gamma chain
      • IL2RG
      • IMD4
      • Interleukin-2 receptor subunit gamma
      • L-2R subunit gamma
      • p64
      see all
    • Relevance

      A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains.
    • Cellular localization

      Membrane; single-pass type I membrane protein

Images

  • SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
    SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

    SDS-PAGE analysis of reduced ab174081 stained overnight with Coomassie Blue. The protein migrates as 95-96 kDa due to glycosylation.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab174081? Please let us know so that we can cite the reference in this datasheet.

    ab174081 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • CD132
      • Cytokine receptor common gamma chain
      • Gamma-C
      • gammaC
      • IL-2 receptor subunit gamma
      • IL-2RG
      • IL2R gamma chain
      • IL2RG
      • IMD4
      • Interleukin-2 receptor subunit gamma
      • L-2R subunit gamma
      • p64
      see all
    • Relevance

      A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains.
    • Cellular localization

      Membrane; single-pass type I membrane protein

    Images

    • SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
      SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

      SDS-PAGE analysis of reduced ab174081 stained overnight with Coomassie Blue. The protein migrates as 95-96 kDa due to glycosylation.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

    •  
    • Recombinant Human soluble IL2 Receptor gamma protein (ab191927)

      Applications: HPLC, SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-CD79b antibody [EPR6861] - BSA and Azide free (ab240083)

    •  
    • Product image

      Anti-CD23 antibody [SP163] - BSA and Azide free (ab245732)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.