Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: proprietary tag C-Terminus
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera)
See all soluble IL2 Receptor gamma proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEI HLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLEL NWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFR VRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN -
Predicted molecular weight
54 kDa including tags -
Amino acids
23 to 254 -
Tags
proprietary tag C-Terminus -
Additional sequence information
Fused with Fc fragment of human IgG1 at the C-terminus. Extracellular domain. The predicted N-terminus is Leu 23. DTT-reduced Protein migrates as 80-90 kDa due to glycosylation. (AAH14972)
Specifications
Our Abpromise guarantee covers the use of ab174081 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.75% Glycine, 0.6% Tris, 3% Trehalose
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% -
ReconstitutionReconstitute with sterile deionized water to a concentration of 50 µg/ml.
General Info
-
Alternative names
- CD132
- Cytokine receptor common gamma chain
- Gamma-C
see all -
Relevance
A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains. -
Cellular localization
Membrane; single-pass type I membrane protein
Images
-
SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
SDS-PAGE analysis of reduced ab174081 stained overnight with Coomassie Blue. The protein migrates as 95-96 kDa due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab174081 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- CD132
- Cytokine receptor common gamma chain
- Gamma-C
see all -
Relevance
A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains. -
Cellular localization
Membrane; single-pass type I membrane protein
Images
-
SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
SDS-PAGE analysis of reduced ab174081 stained overnight with Coomassie Blue. The protein migrates as 95-96 kDa due to glycosylation.
