Astana Biomed Group, an authorized Abcam distributor in Central Asia

Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level:
  • Tags: proprietary tag C-Terminus
  • Suitable for: SDS-PAGE

Description

  • Product name

    Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera)
    See all soluble IL2 Receptor gamma proteins and peptides

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    HEK 293 cells

  • Accession

    P31785

  • Protein length

    Protein fragment

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Human

    • Sequence

      LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEI HLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLEL NWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFR VRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

    • Predicted molecular weight

      54 kDa including tags

    • Amino acids

      23 to 254

    • Tags

      proprietary tag C-Terminus

    • Additional sequence information

      Fused with Fc fragment of human IgG1 at the C-terminus. Extracellular domain. The predicted N-terminus is Leu 23. DTT-reduced Protein migrates as 80-90 kDa due to glycosylation. (AAH14972)

    • Specifications

    Our Abpromise guarantee covers the use of ab174081 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized

    • Additional notes

      This product is stable after storage at:

      • -20°C to -70°C for 12 months in lyophilized state;
      • -70°C for 3 months under sterile conditions after reconstitution.
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 7.4
      Constituents: 0.75% Glycine, 0.6% Tris, 3% Trehalose

      5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    • Reconstitution
      Reconstitute with sterile deionized water to a concentration of 50 µg/ml.

    General Info

    • Alternative names

      • CD132
      • Cytokine receptor common gamma chain
      • Gamma-C
      • gammaC
      • IL-2 receptor subunit gamma
      • IL-2RG
      • IL2R gamma chain
      • IL2RG
      • IMD4
      • Interleukin-2 receptor subunit gamma
      • L-2R subunit gamma
      • p64
      see all

    • Relevance

      A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains.

    • Cellular localization

      Membrane; single-pass type I membrane protein

Images

  • SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
    SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

    SDS-PAGE analysis of reduced ab174081 stained overnight with Coomassie Blue. The protein migrates as 95-96 kDa due to glycosylation.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab174081? Please let us know so that we can cite the reference in this datasheet.

ab174081 has not yet been referenced specifically in any publications.

Preparation and Storage

  • Alternative names

    • CD132
    • Cytokine receptor common gamma chain
    • Gamma-C
    • gammaC
    • IL-2 receptor subunit gamma
    • IL-2RG
    • IL2R gamma chain
    • IL2RG
    • IMD4
    • Interleukin-2 receptor subunit gamma
    • L-2R subunit gamma
    • p64
    see all

  • Relevance

    A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains.

  • Cellular localization

    Membrane; single-pass type I membrane protein

Images

  • SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)
    SDS-PAGE - Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

    SDS-PAGE analysis of reduced ab174081 stained overnight with Coomassie Blue. The protein migrates as 95-96 kDa due to glycosylation.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

Sign up