Recombinant human RANTES protein (Animal Free) (ab217444)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant human RANTES protein (Animal Free)
See all RANTES proteins and peptides -
Biological activity
Determined by its ability to chemoattract Human blood monocytes using a concentration range of 1.0-10.0 ng/ml.
-
Purity
> 98 % SDS-PAGE.
> 98 % HPLC. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVC ANPEKKWVREYINSLEMS -
Predicted molecular weight
8 kDa -
Amino acids
24 to 91 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.