Recombinant Human Profilin 2 protein (ab185845)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human Profilin 2 protein
See all Profilin 2 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity is determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDM IVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYN VAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF -
Predicted molecular weight
15 kDa -
Amino acids
1 to 140
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab185845 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.24% Tris, 0.88% Sodium chloride
Lyophilized from a 0.2 µM filtered solution
General Info
-
Alternative names
- D3S1319E
- PFL
- PFN 2
see all -
Function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. -
Tissue specificity
Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver. -
Sequence similarities
Belongs to the profilin family. -
Cellular localization
Cytoplasm > cytoskeleton. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab185845 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.24% Tris, 0.88% Sodium chloride
Lyophilized from a 0.2 µM filtered solution