Recombinant Human Myeloperoxidase protein (ab158915)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
-
Product name
Recombinant Human Myeloperoxidase protein
See all Myeloperoxidase proteins and peptides -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALA QISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS -
Amino acids
646 to 745 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- 84 kDa myeloperoxidase
- 89 kDa myeloperoxidase
- EC 1.11.1.7
see all -
Function
Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity. -
Involvement in disease
Defects in MPO are the cause of myeloperoxidase deficiency (MPD) [MIM:254600]. MPD is an autosomal recessive defect that results in disseminated candidiasis. -
Sequence similarities
Belongs to the peroxidase family. XPO subfamily. -
Cellular localization
Lysosome. - Information by UniProt