Recombinant human LTBR protein (Fc Chimera Active) (ab215015)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human LTBR protein (Fc Chimera Active)
See all LTBR proteins and peptides -
Biological activity
Shows the biological function of the LTBR moiety and exerts a prolonged circulating half-life caused by the modified Fc domain.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVC ATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGM FCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTM -
Predicted molecular weight
22 kDa -
Amino acids
31 to 225 -
Additional sequence information
Fused to the N-terminus of the Fc region of a mutant human IgG1 (NP_002333.1).
Specifications
Our Abpromise guarantee covers the use of ab215015 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilised from 0.2µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute at 100 µg/mL in sterile PBS.
General Info
-
Alternative names
- CD18
- D12S370
- LT beta R
see all -
Function
Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215015 has not yet been referenced specifically in any publications.
Preparation and Storage
- CD18
- D12S370
- LT beta R