Recombinant human IL-9 protein (Animal Free) (ab217417)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
-
Product name
Recombinant human IL-9 protein (Animal Free)
See all IL-9 proteins and peptides -
Biological activity
Determined by its ability to stimulate the proliferation of human MO7e cells. The expected ED50 is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5 x 106 units/mg.
-
Purity
> 98 % SDS-PAGE.
> 98% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRP CFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTT AGNALTFLKSLLEIFQKEKMRGMRGKI -
Predicted molecular weight
14 kDa -
Amino acids
19 to 144 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
