Recombinant human IL-29 protein (ab200263)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
-
Product name
Recombinant human IL-29 protein
See all IL-29 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 is determined in an anti-viral assay using Human HepG2 cells infected with encephalomyocarditis is typically 1-5 ng/ml.
-
Purity
> 97 % SDS-PAGE.
ab200263 is >97% pure as determined by SDS-PAGE and HPLC analyses. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPV FPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLH HILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFN LFRLLTRDLKYVADGNLCLRTSTHPEST -
Predicted molecular weight
20 kDa -
Amino acids
23 to 200
Associated products
Specifications
Our Abpromise guarantee covers the use of ab200263 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C.
pH: 7.40
Constituents: 0.75% Sodium chloride, 99% Phosphate BufferThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
General Info
-
Alternative names
- Cytokine ZCYTO21
- IFN lambda 1
- IFN-lambda-1
see all -
Function
Cytokine with immunomodulatory activity. May play a role in antiviral immunity. Up-regulates MHC class I antigen expression. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. -
Sequence similarities
Belongs to the IL-28/IL-29 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab200263 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- Cytokine ZCYTO21
- IFN lambda 1
- IFN-lambda-1
see all -
Function
Cytokine with immunomodulatory activity. May play a role in antiviral immunity. Up-regulates MHC class I antigen expression. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. -
Sequence similarities
Belongs to the IL-28/IL-29 family. -
Cellular localization
Secreted. - Information by UniProt
