Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Chemokines Beta Chemokines (CC)

Recombinant human herpesvirus viral MIP2 protein (Active) (ab243959)

Key features and details

  • Expression system: Escherichia coli
  • Endotoxin level:
  • Active: Yes
  • Suitable for: HPLC, SDS-PAGE, Functional Studies

You may also be interested in

Product image
Mouse MDC Matched Antibody Pair Kit (ab211760)
Product image
Mouse CCL28 ELISA Kit (ab210578)
Product image
Anti-CCL25 antibody - BSA and Azide free (Detector) (ab259496)
Product image
Human CCL28 Antibody Pair - BSA and Azide free (ab241875)

Description

  • Product name

    Recombinant human herpesvirus viral MIP2 protein (Active)
    See all viral MIP2 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The specific activity is determined by the inhibitory effect on monocyte migration response to human MIP-1 alpha using a concentration range of 1.0 µg-10.0 µg/ml of viral MIP-2 will inhibit 25 ng/ml of human MIP-1 alpha.

  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    Q98157
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human herpesvirus
    • Sequence

      LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQV CADKSKDWVKKLMQQLPVTA
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 93
    • Additional sequence information

      Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus).
  • Specifications

    Our Abpromise guarantee covers the use of ab243959 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      HPLC

      SDS-PAGE

      Functional Studies

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      Constituent: PBS

      0.2 µm filtered

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20degC. Further dilutions should be made in appropriate buffered solutions.

    General Info

    • Alternative names

      • Viral macrophage inflammatory protein II
      • vMIP 1B
      • vMIP II
    • Relevance

      vMIP2 is a chemokine analog encoded by the human herpesvirus (HHV8) and is a potent in vitro antagonist of many chemokine receptors. In vivo vMIP2 has been shown to be a potent inhibitor of type 1 T-cell-mediated inflammation. Three chemokine-like proteins, vMIP-I, vMIP-II and vMIP-III are encoded within the HHV8 genome. Among human chemokines, vMIP2 is most closely related to MIP-1a, sharing approximately 41% amino acid sequence identity. The CC chemokine receptor (CCR) 8 belongs to the seven transmembrane-spanning receptor families and functionally responds to the eukaryotic CC chemokines I-309, MIP 1b and vMIPI and vMIP2. Both vMIP I and vMIP2 partially block HIV infection of peripheral blood mononuclear cells. vMIPI and vMIP2 are also highly angiogenic. Chemokines play a profound role in leukocyte trafficking and the development of adaptive immune responses. Perhaps due to their importance in host defense, viruses have adopted many of the hallmarks displayed by chemokines. One therapeutic strategy to prevent accumulation of pro-inflammatory immune cells is the use of specific chemokine receptor antagonists. An interesting and promising candidate in this context is the viral antagonist vMIP2 as this molecule acts on a broad spectrum of chemokine receptors.
    • Cellular localization

      Secreted

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab243959? Please let us know so that we can cite the reference in this datasheet.

    ab243959 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Viral macrophage inflammatory protein II
    • vMIP 1B
    • vMIP II

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant human herpesvirus viral MIP2 protein (Active) (ab243959)

    •  
    • Recombinant herpes simplex virus viral MIP2 protein (ab50234)

      Applications: Inhibition, SDS-PAGE

    •  
    • Recombinant herpes simplex virus viral MIP2 protein (ab201382)

      Applications: FuncS, HPLC, SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-ZFY antibody (ab155318)

    •  
    • Product image

      Human ATF6 knockout HeLa cell pellet (ab278835)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.