Recombinant human herpesvirus viral MIP2 protein (Active) (ab243959)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
-
Product name
Recombinant human herpesvirus viral MIP2 protein (Active)
See all viral MIP2 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The specific activity is determined by the inhibitory effect on monocyte migration response to human MIP-1 alpha using a concentration range of 1.0 µg-10.0 µg/ml of viral MIP-2 will inhibit 25 ng/ml of human MIP-1 alpha.
-
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human herpesvirus -
Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQV CADKSKDWVKKLMQQLPVTA -
Predicted molecular weight
8 kDa -
Amino acids
24 to 93 -
Additional sequence information
Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus).
Specifications
Our Abpromise guarantee covers the use of ab243959 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20degC. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- Viral macrophage inflammatory protein II
- vMIP 1B
- vMIP II
-
Relevance
vMIP2 is a chemokine analog encoded by the human herpesvirus (HHV8) and is a potent in vitro antagonist of many chemokine receptors. In vivo vMIP2 has been shown to be a potent inhibitor of type 1 T-cell-mediated inflammation. Three chemokine-like proteins, vMIP-I, vMIP-II and vMIP-III are encoded within the HHV8 genome. Among human chemokines, vMIP2 is most closely related to MIP-1a, sharing approximately 41% amino acid sequence identity. The CC chemokine receptor (CCR) 8 belongs to the seven transmembrane-spanning receptor families and functionally responds to the eukaryotic CC chemokines I-309, MIP 1b and vMIPI and vMIP2. Both vMIP I and vMIP2 partially block HIV infection of peripheral blood mononuclear cells. vMIPI and vMIP2 are also highly angiogenic. Chemokines play a profound role in leukocyte trafficking and the development of adaptive immune responses. Perhaps due to their importance in host defense, viruses have adopted many of the hallmarks displayed by chemokines. One therapeutic strategy to prevent accumulation of pro-inflammatory immune cells is the use of specific chemokine receptor antagonists. An interesting and promising candidate in this context is the viral antagonist vMIP2 as this molecule acts on a broad spectrum of chemokine receptors. -
Cellular localization
Secreted
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243959 has not yet been referenced specifically in any publications.
Preparation and Storage
- Viral macrophage inflammatory protein II
- vMIP 1B
- vMIP II