Recombinant Human hCG beta protein (ab191924)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human hCG beta protein
See all hCG beta proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQVDHHH HHH -
Predicted molecular weight
17 kDa including tags -
Amino acids
21 to 165 -
Tags
His tag C-Terminus -
Additional sequence information
This product is the mature full length protein from aa 21 to 165. The signal peptide is not included.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab191924 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer
Lyophilized from a 0.2 µM filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- CG beta
- CG-beta
- CgB
see all -
Relevance
Function: Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. Tissue specificity: Placenta. Similarity: Belongs to the glycoprotein hormones subunit beta family. Developmental stage: Made by the first trimester placenta.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab191924 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer
Lyophilized from a 0.2 µM filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
