Recombinant Human GDF7 protein (ab115505)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant Human GDF7 protein -
Biological activity
Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells. -
Purity
> 98 % SDS-PAGE.
ab115505 is greater than 98% by SDS-PAGE gel and HPLC analyses. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPL DYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS PISILYIDAANNVVYKQYEDMVVEACGCR -
Predicted molecular weight
28 kDa -
Amino acids
322 to 450
Specifications
Our Abpromise guarantee covers the use of ab115505 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
-
ReconstitutionPlease note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
General Info
-
Alternative names
- bmp12
- bone morphogenetic protein 12
- GDF-7
see all -
Function
May play an active role in the motor area of the primate neocortex. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab115505 has not yet been referenced specifically in any publications.
Preparation and Storage
- bmp12
- bone morphogenetic protein 12
- GDF-7