Recombinant human GDF15 protein (ab50077)
Key features and details
- Expression system: CHO cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human GDF15 protein
See all GDF15 proteins and peptides -
Biological activity
Determined by its ability to inhibit alkaline phosphatase activity in differentiating MC3T3/E1 osetoblast cells. The expected ED50 for this effect is 75-200 ng/ml.
-
Purity
> 95 % SDS-PAGE.
ab50077 purity was determined also by HPLC -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPS QFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQT YDDLLAKDCHCI -
Amino acids
197 to 308 -
Additional sequence information
This product refers to the processed mature form of this protein from aa 195 to 308. Therefore it does not contain the signal peptide or propeptide.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab50077 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute to 1mg/ml with distilled water.
General Info
-
Alternative names
- GDF 15
- GDF-15
- Gdf15
see all -
Tissue specificity
Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab50077 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- GDF 15
- GDF-15
- Gdf15
see all -
Tissue specificity
Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt