Recombinant human Fas Ligand protein (ab157085)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: > 0.100 Eu/µg
- Active: Yes
- Tags: DDDDK tag N-Terminus
- Suitable for: WB, ELISA, Functional Studies, SDS-PAGE
-
Product name
Recombinant human Fas Ligand protein
See all Fas Ligand proteins and peptides -
Biological activity
ED50: 50ng/ml (A20 cells). Kills Jurkat cells at concentrations of >10ng/ml in the absence of a cross-linker. Cross-linking enhancer increases the activity of rhsFasL approx. 50-fold. Please note: Results using sFasL may differ from those obtained with agonistic antibodies. -
Purity
> 95 % SDS-PAGE.
ab157085 is purified by Multi-Step Chromatography. -
Endotoxin level
> 0.100 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKG GLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKM MSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLY KL -
Predicted molecular weight
32 kDa including tags -
Amino acids
103 to 281 -
Tags
DDDDK tag N-Terminus
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum.
Images
-
Functional Studies - Recombinant human Fas Ligand protein (ab157085)Activity Assay analysis: Inhibition of ab157085-mediated lysis. Fas (human):Fc (Human) (rec.) exerts its inhibitory activity in a concentration range of 0.5-5μg/ml in the presence of the enhancer (1μg/ml).
