Recombinant Human ESAM protein (ab151384)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human ESAM protein
See all ESAM proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKE KEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVN VQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRS KPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNE VGTAQCNVTLEVSTGPGAVDHHHHHH -
Predicted molecular weight
25 kDa including tags -
Amino acids
30 to 247 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab151384 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
pH: 7.20
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionDissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7oC for 2-7 days. Aliquots of reconstituted samples are stable at oC for 3 months.
General Info
-
Alternative names
- 2310008D05Rik
- Endothelial cell adhesion molecule
- Endothelial cell selective adhesion molecule
see all -
Function
Can mediate aggregation most likely through a homophilic molecular interaction. -
Tissue specificity
Highly expressed in endothelial cells. -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell junction > adherens junction. Cell junction > tight junction. Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab151384 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
pH: 7.20
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionDissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7oC for 2-7 days. Aliquots of reconstituted samples are stable at oC for 3 months.