Recombinant Human ENSA protein (His tag) (ab219690)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Endotoxin level:
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human ENSA protein (His tag)
See all ENSA proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
SQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGS DFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPD LPQRKSSLVTSKLAGGQVE -
Predicted molecular weight
14 kDa including tags -
Amino acids
2 to 121 -
Tags
His tag N-Terminus -
Additional sequence information
(AAH00436).
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab219690 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 95% PBS
Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. -
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- Alpha endosulfine
- ARPP 19e
- Endosulfine alpha
-
Relevance
ENSA (Alpha endosulfine) is expressed in a wide range of tissues including muscle, brain, and endocrine tissues. The recombinant protein inhibits binding of labeled glibenclamide to beta cell membranes. It also inhibits cloned K(ATP) channel currents and thereby stimulates insulin secretion. It was proposed that endosulfine is an endogenous regulator of the K(ATP) channel, which has a key role in the control of insulin release and, more generally, couples cell metabolism to electrical activity. -
Cellular localization
Cytoplasmic
Images
-
SDS-PAGE - Recombinant Human ENSA protein (His tag) (ab219690)
SDS-PAGE analysis of DTT-reduced ab219690 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 18 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab219690 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 95% PBS
Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. -
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
Images
-
SDS-PAGE - Recombinant Human ENSA protein (His tag) (ab219690)
SDS-PAGE analysis of DTT-reduced ab219690 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 18 kDa.
