Recombinant Human EGF protein (Fc Chimera) (ab216241)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human EGF protein (Fc Chimera)
See all EGF proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELR -
Predicted molecular weight
6 kDa -
Amino acids
971 to 1023 -
Additional sequence information
The extracellular domain of Human EGF (aa 971-1023) is fused to the N-terminus of the Fc region of Human IgG1.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab216241 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 100% PBS
-
ReconstitutionReconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.
General Info
-
Alternative names
- Beta urogastrone
- beta-urogastrone
- EGF
see all -
Function
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941). -
Tissue specificity
Expressed in kidney, salivary gland, cerebrum and prostate. -
Involvement in disease
Hypomagnesemia 4 -
Sequence similarities
Contains 9 EGF-like domains.
Contains 9 LDL-receptor class B repeats. -
Post-translational
modificationsO-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor). -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab216241 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- Beta urogastrone
- beta-urogastrone
- EGF
see all -
Function
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941). -
Tissue specificity
Expressed in kidney, salivary gland, cerebrum and prostate. -
Involvement in disease
Hypomagnesemia 4 -
Sequence similarities
Contains 9 EGF-like domains.
Contains 9 LDL-receptor class B repeats. -
Post-translational
modificationsO-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor). -
Cellular localization
Membrane. - Information by UniProt
