Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Growth Factors/Hormones EGF

Recombinant Human EGF protein (Fc Chimera) (ab216241)

Key features and details

  • Expression system: CHO cells
  • Purity: >= 98% SDS-PAGE
  • Endotoxin level:
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Anti-Amphiregulin antibody (ab224350)
Product image
Anti-Amphiregulin antibody - BSA and Azide free (Detector) (ab244915)
Product image
Human Epiregulin ELISA Kit (ab213775)
Product image
Recombinant human Amphiregulin protein (Animal Free) (ab229598)

Description

  • Product name

    Recombinant Human EGF protein (Fc Chimera)
    See all EGF proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    CHO cells
  • Accession

    P01133
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELR
    • Predicted molecular weight

      6 kDa
    • Amino acids

      971 to 1023
    • Additional sequence information

      The extracellular domain of Human EGF (aa 971-1023) is fused to the N-terminus of the Fc region of Human IgG1.
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab216241 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

        Constituent: 100% PBS

      • Reconstitution
        Reconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.

      General Info

      • Alternative names

        • Beta urogastrone
        • beta-urogastrone
        • EGF
        • EGF_HUMAN
        • Epidermal growth factor
        • HOMG4
        • OTTHUMP00000219721
        • OTTHUMP00000219722
        • Pro epidermal growth factor
        • URG
        • Urogastrone
        see all
      • Function

        EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941).
      • Tissue specificity

        Expressed in kidney, salivary gland, cerebrum and prostate.
      • Involvement in disease

        Hypomagnesemia 4
      • Sequence similarities

        Contains 9 EGF-like domains.
        Contains 9 LDL-receptor class B repeats.
      • Post-translational
        modifications

        O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).
      • Cellular localization

        Membrane.
      • Target information above from: UniProt accession P01133 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab216241? Please let us know so that we can cite the reference in this datasheet.

    ab216241 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • Beta urogastrone
      • beta-urogastrone
      • EGF
      • EGF_HUMAN
      • Epidermal growth factor
      • HOMG4
      • OTTHUMP00000219721
      • OTTHUMP00000219722
      • Pro epidermal growth factor
      • URG
      • Urogastrone
      see all
    • Function

      EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941).
    • Tissue specificity

      Expressed in kidney, salivary gland, cerebrum and prostate.
    • Involvement in disease

      Hypomagnesemia 4
    • Sequence similarities

      Contains 9 EGF-like domains.
      Contains 9 LDL-receptor class B repeats.
    • Post-translational
      modifications

      O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession P01133 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant Human EGF protein (Fc Chimera) (ab216241)

    •  
    • Product image

      Recombinant Human EGF protein (ab55483)

      Applications: FuncS, SDS-PAGE, WB

    •  
    • Product image

      Recombinant human EGF protein (Active) (ab259398)

      Applications: Cell Culture, FuncS, HPLC, MS, SDS-PAGE

    •  
    • Product image

      Recombinant human EGF protein (Animal Free) (ab9697)

      Applications: CellAct, HPLC, SDS-PAGE, WB

    •  
    • Product image

      Recombinant mouse EGF protein (ab72994)

      Applications: FuncS, SDS-PAGE

    •  
    • Product image

      Recombinant human EGF protein (Animal Free) (ab179628)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant Mouse EGF protein (ab126695)

      Applications: MS, SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-GSK3 beta antibody [Y174] (ab32391)

    •  
    • Product image

      Anti-STK3/MST-2 antibody [EP1466Y] (ab52641)

    •  
    • Product image

      Anti-IL-33 antibody [EPR20417] (ab207737)

    •  
    • Product image

      Anti-Growth Hormone antibody [EPR11047(B)] (ab155276)

    •  
    • Product image

      Anti-MCM2 antibody [CRCT2.1 (D1.9H5)] (ab6153)

    •  
    • Product image

      Anti-Glycogen synthase 1/GYS1 antibody - C-terminal (ab186068)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.