Recombinant Human Chemerin protein (ab256228)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human Chemerin protein
See all Chemerin proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLE FKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPI ETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS -
Predicted molecular weight
16 kDa -
Amino acids
21 to 157 -
Additional sequence information
Full length chain without signal peptide, without propeptide.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab256228 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid
0.2 micron filtered -
ReconstitutionSterile water to 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- HP10433
- RAR responsive protein TIG2
- RAR-responsive protein TIG2
see all -
Tissue specificity
Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Chemerin protein (ab256228)
4-20% SDS-PAGE - Recombinant Human Chemerin protein (ab256228 1µg per lane).
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
Coomassie blue staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab256228 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- HP10433
- RAR responsive protein TIG2
- RAR-responsive protein TIG2
see all -
Tissue specificity
Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Chemerin protein (ab256228)
4-20% SDS-PAGE - Recombinant Human Chemerin protein (ab256228 1µg per lane).
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
Coomassie blue staining.