Recombinant human CD137 protein (Fc Chimera Active) (ab215031)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human CD137 protein (Fc Chimera Active)
See all CD137 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQC KGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCK DCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPG ASSVTPPAPAREPGHS -
Predicted molecular weight
55 kDa including tags -
Amino acids
19 to 184 -
Additional sequence information
The extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a (AAH06196.1).
Associated products
Specifications
Our Abpromise guarantee covers the use of ab215031 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 99% PBS
Lyophilized from 0.2µm-filtered solution in PBS.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute 100 µg vial with 100 µL sterile water to a concentration of 1mg/ml. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- 4 1BB
- 4 1BB ligand receptor
- 4-1BB ligand receptor
see all -
Function
Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. -
Tissue specificity
Expressed on the surface of activated T-cells. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215031 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- 4 1BB
- 4 1BB ligand receptor
- 4-1BB ligand receptor
see all -
Function
Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. -
Tissue specificity
Expressed on the surface of activated T-cells. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt