Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Recombinant human CD137 protein (Fc Chimera Active) (ab215031)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: >= 98% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Product image
Recombinant Human Tspan-8 protein (Fc Chimera) (ab276679)
Product image
Recombinant Fe/S biogenesis protein NfuA (Tagged) (ab267922)
Product image
Human DGAT2 knockout HeLa cell line (ab265446)
Product image
Anti-ST2 antibody (ab208283)

Description

  • Product name

    Recombinant human CD137 protein (Fc Chimera Active)
    See all CD137 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    HEK 293 cells
  • Accession

    Q07011
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQC KGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCK DCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPG ASSVTPPAPAREPGHS
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      19 to 184
    • Additional sequence information

      The extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a (AAH06196.1).
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab215031 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        Functional Studies

        SDS-PAGE

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

        Constituent: 99% PBS

        Lyophilized from 0.2µm-filtered solution in PBS.

        This product is an active protein and may elicit a biological response in vivo, handle with caution.

      • Reconstitution
        Reconstitute 100 µg vial with 100 µL sterile water to a concentration of 1mg/ml. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.

      General Info

      • Alternative names

        • 4 1BB
        • 4 1BB ligand receptor
        • 4-1BB ligand receptor
        • 4-1BB Ligand Receptor T Cell
        • 4-1BB, mouse, homolog of
        • Antigen 4-1BB Homolog
        • CD 137
        • CD137
        • CD137 antigen
        • CDw137
        • HLDA VI
        • Homolog of mouse 4 1BB
        • ILA
        • Induced by lymphocyte activation
        • induced by lymphocyte activation (ILA)
        • Interleukin activated receptor homolog of mouse Ly63
        • Ly63, mouse, homolog of
        • MGC2172
        • OTTHUMP00000044294
        • Receptor protein 4 1BB
        • T cell antigen 4 1BB homolog
        • T cell antigen ILA
        • T-cell antigen 4-1BB homolog
        • T-cell antigen ILA
        • TNF receptor superfamily member 9
        • TNFRSF9
        • TNR9_HUMAN
        • Tumor necrosis factor receptor superfamily member 9
        see all
      • Function

        Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
      • Tissue specificity

        Expressed on the surface of activated T-cells.
      • Sequence similarities

        Contains 4 TNFR-Cys repeats.
      • Cellular localization

        Membrane.
      • Target information above from: UniProt accession Q07011 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab215031? Please let us know so that we can cite the reference in this datasheet.

    ab215031 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • 4 1BB
      • 4 1BB ligand receptor
      • 4-1BB ligand receptor
      • 4-1BB Ligand Receptor T Cell
      • 4-1BB, mouse, homolog of
      • Antigen 4-1BB Homolog
      • CD 137
      • CD137
      • CD137 antigen
      • CDw137
      • HLDA VI
      • Homolog of mouse 4 1BB
      • ILA
      • Induced by lymphocyte activation
      • induced by lymphocyte activation (ILA)
      • Interleukin activated receptor homolog of mouse Ly63
      • Ly63, mouse, homolog of
      • MGC2172
      • OTTHUMP00000044294
      • Receptor protein 4 1BB
      • T cell antigen 4 1BB homolog
      • T cell antigen ILA
      • T-cell antigen 4-1BB homolog
      • T-cell antigen ILA
      • TNF receptor superfamily member 9
      • TNFRSF9
      • TNR9_HUMAN
      • Tumor necrosis factor receptor superfamily member 9
      see all
    • Function

      Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
    • Tissue specificity

      Expressed on the surface of activated T-cells.
    • Sequence similarities

      Contains 4 TNFR-Cys repeats.
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession Q07011 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant human CD137 protein (Fc Chimera Active) (ab215031)

    •  
    • Product image

      Recombinant Mouse CD137 protein (ab208312)

      Applications: SDS-PAGE

    •  
    • Product image

      Recombinant Human CD137 protein (ab124589)

      Applications: MS, SDS-PAGE

    •  
    • Product image

      Recombinant Human CD137 protein (ab198422)

      Applications: SDS-PAGE

    •  
    • Product image

      Recombinant Human CD137 protein (Biotin) (ab198465)

      Applications: SDS-PAGE

    •  
    • Product image

      Recombinant cynomolgus monkey CD137 protein (Active) (ab220574)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant human CD137 protein (ab50088)

      Applications: Inhibition, SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-Ndufs4 antibody [EP7832] (ab137064)

    •  
    • Product image

      Anti-CD99 antibody [EPR3097Y] (ab75858)

    •  
    • Product image

      Anti-AAMP antibody [EPR12369] (ab178691)

    •  
    • Product image

      Anti-NOTCH4 antibody [EPNCIR101B] (ab166605)

    •  
    • Product image

      Anti-RBCK1 antibody [CL4289] (ab219955)

    •  
    • Product image

      Anti-TTF1 antibody [8G7G3/1] (ab233977)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.