Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Complement Classical Pathway

Recombinant Human C3 protein (ab157985)

Recombinant Human C3 protein (ab157985)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Wheat germ
  • Tags: GST tag N-Terminus
  • Suitable for: ELISA, WB

You may also be interested in

Product image
Human C3 Antibody Pair - BSA and Azide free (ab253561)
Product image
Anti-C4d antibody [A24-T] (ab136921)
TRITC Anti-C3c antibody (ab182907)
Product image
Anti-C3a / C3a des Arg antibody [K13/16] (ab36385)

Description

  • Product name

    Recombinant Human C3 protein
    See all C3 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

    718
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRT FISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPE EDECQDEENQK
    • Predicted molecular weight

      38 kDa
    • Amino acids

      1534 to 1644
    • Tags

      GST tag N-Terminus

Preparation and Storage

  • Alternative names

    • Acylation stimulating protein cleavage product
    • AHUS5
    • ARMD9
    • ASP
    • C3
    • C3 and PZP like alpha 2 macroglobulin domain containing protein 1
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1
    • c3 complement
    • C3adesArg
    • CO3_HUMAN
    • Complement C3
    • Complement C3 alpha chain
    • Complement C3b alpha' chain
    • Complement C3c alpha' chain fragment 1
    • Complement C3c alpha' chain fragment 2
    • Complement C3c alpha'' chain fragment 2
    • Complement C3d fragment
    • Complement C3dg fragment
    • Complement C3f fragment
    • Complement C3g fragment
    • Complement component 3
    • Complement factor 3
    • CPAMD1
    • HEL S 62p
    • omplement C3 beta chain
    see all
  • Function

    C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.
    Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Defects in C3 are the cause of complement component 3 deficiency (C3D) [MIM:120700]. A rare defect of the complement classical pathway. Patients develop recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Some patients may also develop autoimmune disorders, such as arthralgia and vasculitic rashes, lupus-like syndrome and membranoproliferative glomerulonephritis.
    Genetic variation in C3 is associated with susceptibility to age-related macular degeneration type 9 (ARMD9) [MIM:611378]. ARMD is a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane.
    Defects in C3 are a cause of susceptibility to hemolytic uremic syndrome atypical type 5 (AHUS5) [MIM:612925]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype.
  • Sequence similarities

    Contains 1 anaphylatoxin-like domain.
    Contains 1 NTR domain.
  • Post-translational
    modifications

    C3b is rapidly split in two positions by factor I and a cofactor to form iC3b (inactivated C3b) and C3f which is released. Then iC3b is slowly cleaved (possibly by factor I) to form C3c (beta chain + alpha' chain fragment 1 + alpha' chain fragment 2), C3dg and C3f. Other proteases produce other fragments such as C3d or C3g.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P01024 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human C3 protein (ab157985)
    SDS-PAGE - Recombinant Human C3 protein (ab157985)
    ab157985 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human C3 protein (ab157985)

  •  
  • Synthetic Human C3 protein (Biotin) (ab176059)

    Applications: HPLC

  •  
  • Product image

    Recombinant Mouse C3 protein (His tag) (ab226433)

    Applications: SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Recombinant Human Sin3b protein (ab161600)

  •  
  • Product image

    Recombinant mouse SCF protein (ab106309)

  •  
  • Product image

    Recombinant Human Testin protein (ab99213)

  •  
  • Product image

    Human NUDT2 knockout HeLa cell line (ab265752)

  •  
  • Recombinant Human HSF2 protein (ab151388)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.