Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Growth Factors/Hormones TNF

Recombinant human BCMA protein (Fc Chimera Active) (ab270565)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: >= 95% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Tags: Fc tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Product image
Recombinant human BCMA protein (Active) (ab243796)
Product image
Anti-BAFF-R antibody [5A9B6] (ab233775)
Biotin Anti-BAFF-R antibody [11C1] (ab16582)
Product image
Recombinant Human BCMA protein (His tag) (ab270592)

Description

  • Product name

    Recombinant human BCMA protein (Fc Chimera Active)
    See all BCMA proteins and peptides
  • Biological activity

    Blocks the binding of BAFF and APRIL to their receptors BCMA and TACI, inhibiting BAFF and APRIL-mediated B cell activation.

  • Purity

    >= 95 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    HEK 293 cells
  • Accession

    Q02223
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK GTNAILWTCL
    • Molecular weight information

      ~40kDa by SDS-PAGE
    • Amino acids

      2 to 54
    • Tags

      Fc tag C-Terminus
    • Additional sequence information

      Extracellular domain
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab270565 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        Functional Studies

        SDS-PAGE

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.

        Constituent: PBS

        Buffer lyophilized from

        This product is an active protein and may elicit a biological response in vivo, handle with caution.

      • Reconstitution
        Reconstitute with 50µl sterile water. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. PBS containing at least 0.1% BSA should be used for further dilutions.

      General Info

      • Alternative names

        • B cell maturation antigen
        • B cell maturation factor
        • B cell maturation protein
        • B-cell maturation protein
        • BCM
        • BCMA
        • CD269
        • CD269 antigen
        • TNFRSF17
        • TNR17_HUMAN
        • Tumor necrosis factor receptor superfamily member 17
        see all
      • Function

        Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
      • Tissue specificity

        Expressed in mature B-cells, but not in T-cells or monocytes.
      • Involvement in disease

        Note=A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.
      • Sequence similarities

        Contains 1 TNFR-Cys repeat.
      • Cellular localization

        Cell membrane. Endomembrane system. Perinuclear Golgi-like structures.
      • Target information above from: UniProt accession Q02223 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab270565? Please let us know so that we can cite the reference in this datasheet.

    ab270565 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • B cell maturation antigen
      • B cell maturation factor
      • B cell maturation protein
      • B-cell maturation protein
      • BCM
      • BCMA
      • CD269
      • CD269 antigen
      • TNFRSF17
      • TNR17_HUMAN
      • Tumor necrosis factor receptor superfamily member 17
      see all
    • Function

      Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
    • Tissue specificity

      Expressed in mature B-cells, but not in T-cells or monocytes.
    • Involvement in disease

      Note=A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.
    • Sequence similarities

      Contains 1 TNFR-Cys repeat.
    • Cellular localization

      Cell membrane. Endomembrane system. Perinuclear Golgi-like structures.
    • Target information above from: UniProt accession Q02223 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-VEGF Receptor 2 antibody (ab11939)

    •  
    • Product image

      Anti-p18 INK4c/CDKN2C antibody (ab226992)

    •  
    • Product image

      FITC Anti-Dectin-1 antibody [2A11] (ab21646)

    •  
    • Product image

      Biotin Anti-LIF antibody (ab245854)

    •  
    • Recombinant rat Carboxypeptidase B/CPB protein (ab129141)

    •  
    • Product image

      Recombinant Human Podoplanin / gp36 protein (Tagged) (ab271709)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.