Recombinant human BCMA protein (Fc Chimera Active) (ab270565)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human BCMA protein (Fc Chimera Active)
See all BCMA proteins and peptides -
Biological activity
Blocks the binding of BAFF and APRIL to their receptors BCMA and TACI, inhibiting BAFF and APRIL-mediated B cell activation.
-
Purity
>= 95 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK GTNAILWTCL -
Molecular weight information
~40kDa by SDS-PAGE -
Amino acids
2 to 54 -
Tags
Fc tag C-Terminus -
Additional sequence information
Extracellular domain
Associated products
Specifications
Our Abpromise guarantee covers the use of ab270565 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
Constituent: PBS
Buffer lyophilized fromThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 50µl sterile water. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. PBS containing at least 0.1% BSA should be used for further dilutions.
General Info
-
Alternative names
- B cell maturation antigen
- B cell maturation factor
- B cell maturation protein
see all -
Function
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. -
Tissue specificity
Expressed in mature B-cells, but not in T-cells or monocytes. -
Involvement in disease
Note=A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2. -
Sequence similarities
Contains 1 TNFR-Cys repeat. -
Cellular localization
Cell membrane. Endomembrane system. Perinuclear Golgi-like structures. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab270565 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- B cell maturation antigen
- B cell maturation factor
- B cell maturation protein
see all -
Function
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. -
Tissue specificity
Expressed in mature B-cells, but not in T-cells or monocytes. -
Involvement in disease
Note=A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2. -
Sequence similarities
Contains 1 TNFR-Cys repeat. -
Cellular localization
Cell membrane. Endomembrane system. Perinuclear Golgi-like structures. - Information by UniProt