Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Blood Serum Proteins

Recombinant Human Angiotensin Converting Enzyme 1 protein (ab158266)

Recombinant Human Angiotensin Converting Enzyme 1 protein (ab158266)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Wheat germ
  • Tags: GST tag N-Terminus
  • Suitable for: WB, ELISA

You may also be interested in

Product image
Recombinant Mouse alpha 1 Fetoprotein (ab226406)
Product image
Recombinant Human alpha 1 Fetoprotein (ab207113)
Product image
Anti-Von Willebrand Factor antibody (ab216566)
Product image
HRP Anti-alpha 1 Antitrypsin antibody (ab191350)

Description

  • Product name

    Recombinant Human Angiotensin Converting Enzyme 1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELH GEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQA RGTREAPVYM
    • Amino acids

      592 to 701
    • Tags

      GST tag N-Terminus

Preparation and Storage

  • Alternative names

    • ACE
    • ACE 1
    • ACE T
    • ACE_HUMAN
    • ACE1
    • Angiotensin converting enzyme somatic isoform
    • Angiotensin converting enzyme testis specific isoform
    • Angiotensin I converting enzyme
    • Angiotensin I converting enzyme 1
    • Angiotensin I converting enzyme peptidyl dipeptidase A 1
    • angiotensin I converting enzyme peptidyl-dipeptidase A 1 transcript
    • Angiotensin-converting enzyme
    • Carboxycathepsin
    • CD 143
    • CD143
    • CD143 antigen
    • DCP
    • DCP 1
    • DCP1
    • Dipeptidyl carboxypeptidase 1
    • Dipeptidyl carboxypeptidase I
    • Kininase II
    • MGC26566
    • MVCD3
    • Peptidase P
    • Peptidyl dipeptidase A
    • soluble form
    • Testicular ECA
    see all
  • Function

    Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety.
  • Tissue specificity

    Ubiquitously expressed, with highest levels in lung, kidney, heart, gastrointestinal system and prostate. Isoform Testis-specific is expressed in spermatocytes and adult testis.
  • Involvement in disease

    Ischemic stroke (ISCHSTR) [MIM:601367]: A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Renal tubular dysgenesis (RTD) [MIM:267430]: Autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). Note=The disease is caused by mutations affecting the gene represented in this entry.
    Microvascular complications of diabetes 3 (MVCD3) [MIM:612624]: Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Intracerebral hemorrhage (ICH) [MIM:614519]: A pathological condition characterized by bleeding into one or both cerebral hemispheres including the basal ganglia and the cerebral cortex. It is often associated with hypertension and craniocerebral trauma. Intracerebral bleeding is a common cause of stroke. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the peptidase M2 family.
  • Post-translational
    modifications

    Phosphorylated by CK2 on Ser-1299; which allows membrane retention.
  • Cellular localization

    Secreted and Cell membrane.
  • Target information above from: UniProt accession P12821 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human Angiotensin Converting Enzyme 1 protein (ab158266)
    SDS-PAGE - Recombinant Human Angiotensin Converting Enzyme 1 protein (ab158266)
    ab158266 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PAI1 antibody [1D5] (ab125687)

  •  
  • Product image

    Anti-Pofut1 antibody (ab240479)

  •  
  • Product image

    Anti-ELOVL7 antibody (ab106633)

  •  
  • Product image

    Anti-Urocortin 3 antibody (ab79121)

  •  
  • Product image

    Anti-CD42a/GP-IX antibody (ab186840)

  •  
  • Product image

    Anti-Chk2 (phospho T68) antibody (ab226984)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.