Recombinant Human Alpha Taxilin protein (ab185380)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus, His tag N-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human Alpha Taxilin protein -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGA QERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLE DILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVN GEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH -
Predicted molecular weight
20 kDa including tags -
Amino acids
1 to 162 -
Tags
His tag C-Terminus , His tag N-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab185380 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS.
General Info
-
Alternative names
- Alpha-taxilin
- DKFZp451J0118
- IL 14
see all -
Function
May be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells. -
Tissue specificity
Ubiquitous, with much higher expression in heart, kidney, liver and pancreas. -
Sequence similarities
Belongs to the taxilin family. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab185380 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS.