Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Neurology process Neurodegenerative disease Parkinson's disease Synuclein

Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active) (ab256149)

Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active) (ab256149)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Escherichia coli
  • Active: Yes
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Product image
Anti-LRRK2 (phospho T1357) antibody [MJF-R29-52] - BSA and Azide free (ab270617)
Product image
Anti-Alpha-synuclein antibody (ab216672)
Product image
Recombinant Human beta Synuclein protein (ab82630)
Product image
Anti-Alpha-synuclein antibody [MJFR1] - BSA and Azide free (ab209420)

Description

  • Product name

    Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active)
    See all Alpha-synuclein proteins and peptides
  • Biological activity

    100 µM ab256149 seeded with 10 nM ab256150 in 25 µM Thioflavin T (PBS pH 7.4, 100 µl reaction volume) generated a fluorescence intensity of 28 000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 56 hours. Fluorescence was measured by excitation at 450 nm and emission at 485 nm on a Molecular Devices Gemini XPS microplate reader.

  • Expression system

    Escherichia coli
  • Accession

    P37840
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
    • Predicted molecular weight

      14 kDa
    • Amino acids

      1 to 140
    • Modifications

      mutated A53T
    • Additional sequence information

      NP_000336.1
  • Description

    Recombinant human Alpha-synuclein (mutated A53T) protein (Active)

Preparation and Storage

  • Alternative names

    • Alpha synuclein
    • Alpha-synuclein
    • Alpha-synuclein, isoform NACP140
    • alphaSYN
    • MGC105443
    • MGC110988
    • MGC127560
    • MGC64356
    • NACP
    • Non A beta component of AD amyloid
    • Non A4 component of amyloid
    • Non A4 component of amyloid precursor
    • Non-A beta component of AD amyloid
    • Non-A-beta component of alzheimers disease amyloid , precursor of
    • Non-A4 component of amyloid precursor
    • Non-A4 component of amyloid, precursor of
    • OTTHUMP00000218549
    • OTTHUMP00000218551
    • OTTHUMP00000218552
    • OTTHUMP00000218553
    • OTTHUMP00000218554
    • PARK 1
    • PARK 4
    • PARK1
    • PARK4
    • Parkinson disease (autosomal dominant, Lewy body) 4
    • Parkinson disease familial 1
    • SNCA
    • Snca synuclein
    • Snca synuclein, alpha (non A4 component of amyloid precursor)
    • SYN
    • Synuclein alpha
    • Synuclein alpha 140
    • Synuclein, alpha (non A4 component of amyloid precursor)
    • SYUA_HUMAN
    see all
  • Function

    May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
  • Tissue specificity

    Expressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.
  • Involvement in disease

    Genetic alterations of SNCA resulting in aberrant polymerization into fibrils, are associated with several neurodegenerative diseases (synucleinopathies). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimer disease amyloid plaque, and a major component of Lewy body inclusions. They are also found within Lewy body (LB)-like intraneuronal inclusions, glial inclusions and axonal spheroids in neurodegeneration with brain iron accumulation type 1.
    Parkinson disease 1
    Parkinson disease 4
    Dementia Lewy body
  • Sequence similarities

    Belongs to the synuclein family.
  • Domain

    The 'non A-beta component of Alzheimer disease amyloid plaque' domain (NAC domain) is involved in fibrils formation. The middle hydrophobic region forms the core of the filaments. The C-terminus may regulate aggregation and determine the diameter of the filaments.
  • Post-translational
    modifications

    Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.
    Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.
    Ubiquitinated. The predominant conjugate is the diubiquitinated form.
    Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.
  • Cellular localization

    Cytoplasm, cytosol. Membrane. Nucleus. Cell junction, synapse. Secreted. Membrane-bound in dopaminergic neurons.
  • Target information above from: UniProt accession P37840 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active) (ab256149)
    Functional Studies - Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active) (ab256149)

    Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures such as those in alpha synuclein fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show a limited increase in fluorescence (correlated to alpha synuclein aggregation) over time in ab256149. A much greater increase in fluorescence is seen when 100µM monomer (ab256149) is combined with 10nM of fibrils (ab256150), as the fibrils seed the formation of new fibrils from the pool of active monomers. Thioflavin T ex = 450 nm, em = 485 nm.

  • SDS-PAGE - Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active) (ab256149)
    SDS-PAGE - Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active) (ab256149)

    SDS-PAGE - Recombinant Alpha-synuclein (mutated A53 T) protein (Active) (ab256149).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human Alpha-synuclein (mutated A53T) protein monomer (Active) (ab256149)

  •  
  • Product image

    Anti-Alpha-synuclein (phospho S129) antibody [MJF-R13 (8-8)] (ab168381)

    Applications: WB

  •  
  • Product image

    Anti-Alpha-synuclein antibody [MJFR1] - BSA and Azide free (ab209420)

    Applications: ELISA, Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Alpha-synuclein antibody [MJFR1] (ab138501)

    Applications: ELISA, Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Alpha-synuclein (phospho S129) antibody [EP1536Y] (ab51253)

    Applications: Dot, ELISA, IHC-FrFl, IHC-P, WB

  •  
  • Product image

    Anti-Alpha-synuclein antibody [EPR20535] (ab212184)

    Applications: IHC-Fr, IHC-P, IP, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-Alpha-synuclein antibody [MJFR1] (ab195025)

    Applications: Flow Cyt

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Phosphotyrosine antibody [RM111] (ab190824)

  •  
  • Product image

    Anti-ADX antibody [EPR4629] (ab108257)

  •  
  • Product image

    Anti-ATP6V1H antibody (ab187706)

  •  
  • Product image

    Anti-Apc1 (phospho S377) antibody (ab12206)

  •  
  • Product image

    Anti-C9orf80 antibody (ab121623)

  •  
  • Product image

    Anti-Synaptotagmin 1 + 2 antibody (ab131548)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.