Recombinant hepatitis c virus Hepatitis C Virus 1b core antigen protein (ab198158)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 90% SDS-PAGE
- Active: Yes
- Tags: His-DDDDK tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant hepatitis c virus Hepatitis C Virus 1b core antigen protein
See all Hepatitis C Virus 1b core antigen proteins and peptides -
Biological activity
Specific Activity: ≥ 12 pmole/min/µg
Assay was performed in 100 μl HCV assay buffer containing 50 mM Tris, pH 7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 μM fluorescently labeled HCV substrate peptide. Reaction was monitored at room temperature for 20 min. continuously at ex350/em500.
-
Purity
>= 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Hepatitis C virus -
Sequence
MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSL TGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPI TQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFKAAVCTRGVAKAVDFIP VESMETTMRS -
Predicted molecular weight
22 kDa including tags -
Modifications
mutated R155K -
Tags
His-DDDDK tag N-Terminus -
Additional sequence information
Fusion protein corresponding to the serine protease NS3 (aa 3-181) and cofactor NS4A (aa 21-32) from Hepatitis C virus genotype 1b.
-
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.63% Tris HCl, 2.32% Sodium chloride, 0.2% Triton X-100, 0.08% Beta mercaptoethanol, 30% Glycerol (glycerin, glycerine)
100 µg/mL DDDDK peptideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
Images
-
SDS-PAGE - Recombinant hepatitis c virus Hepatitis C Virus 1b core antigen protein (ab198158)
SDS PAGE analysis of 2 μg ab198158 on 4-20% gel, with Coomassie staining.
-
Functional Studies - Recombinant hepatitis c virus Hepatitis C Virus 1b core antigen protein (ab198158)Activity assay for ab198158.
