Recombinant Endoproteinase Arg-C (Active) (ab245791)
Key features and details
- Expression system: Insect cells
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE, HPLC
-
Product name
Recombinant Endoproteinase Arg-C (Active) -
Biological activity
The reaction is measured as an increase in absorbance at 253 nm resulting from the hydrolysis of N-benzoyl-L-arginine ethyl ester (BAEE).
-
Purity
> 98 % SDS-PAGE.
>98% by HPLC. -
Endotoxin level
Expression system
Insect cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Sequence
GVGDIGSSDYCEKDIVCRVKPSAEFLSASKSVARMVFTPKTGYTGYCSGT LLNNSNSPKRQLFWSAAHCISTQKVANTLQTYWLYDATGCDNDTLSDKAV TLTGGATLLHSHATRDTLLLELKSAPPSGAYYAGWNSSAIATKGTAIEGI HHPSGDLKKYSLGSVTALSSTIDGKKPLTKVAWTTGVTEGGSSGSGLFTI SSTSGYQLRGGLYGGTSYCSAPSDPDYYSQLDGVWSSIKTYFSPHHHHHH HH -
Predicted molecular weight
27 kDa including tags -
Amino acids
220 to 463 -
Tags
His tag C-Terminus -
Additional sequence information
Lysobacter enzymogenes.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab245791 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Sterile filtered through a 0.2 micron filter. Lyophilized from 50mM Tris, pH 8.0 + 10mM CaCl2.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial prior to opening. For best results use only freshly reconstituted protease. Reconstitute in water to 0.1-1.0 mg/ml. Arg-C is activated by DTT, Cysteine, or other sulfhydryl containing reagents. The presence of calcium ions is essential. Arg-C is inhibited by oxidizing agents and sulfhydryl reactants and by Co2+, Cu2+, Cd2+, and heavy metal ions. Do not vortex. Store at 2°C to 8°C for 1 week, or prepare for extended storage.
General Info
-
Relevance
Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at, or adjacent to specific residues, or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes, including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Arg-C specifically cleaves at the carboxyl side of Arginine residues. Arg-C has a sulfhydryl requirement; it is activated by dithiothreitol, cysteine, or other sulfhydryl-containing reagents. The presence of calcium ions is essential. The enzyme is inhibited by oxidizing agents and sulfhydryl reactants, and by Co2+, Cu2+, Cd2+, and heavy metal ions.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab245791 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Sterile filtered through a 0.2 micron filter. Lyophilized from 50mM Tris, pH 8.0 + 10mM CaCl2.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial prior to opening. For best results use only freshly reconstituted protease. Reconstitute in water to 0.1-1.0 mg/ml. Arg-C is activated by DTT, Cysteine, or other sulfhydryl containing reagents. The presence of calcium ions is essential. Arg-C is inhibited by oxidizing agents and sulfhydryl reactants and by Co2+, Cu2+, Cd2+, and heavy metal ions. Do not vortex. Store at 2°C to 8°C for 1 week, or prepare for extended storage.