Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Recombinant Endoproteinase Arg-C (Active) (ab245791)

Key features and details

  • Expression system: Insect cells
  • Purity: > 98% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE, HPLC

You may also be interested in

Product image
Recombinant Human ELOVL4 protein (ab159600)
Product image
5’ Feature Barcode Antibody Conjugation Kit - Lightning-Link® - Oligos 21-30 (ab270709)
Product image
Anti-MORC3 antibody (ab222086)
Product image
Anti-B27 antibody (ab168120)

Description

  • Product name

    Recombinant Endoproteinase Arg-C (Active)
  • Biological activity

    The reaction is measured as an increase in absorbance at 253 nm resulting from the hydrolysis of N-benzoyl-L-arginine ethyl ester (BAEE).

  • Purity

    > 98 % SDS-PAGE.
    >98% by HPLC.
  • Endotoxin level

  • Expression system

    Insect cells
  • Accession

    O87544
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      GVGDIGSSDYCEKDIVCRVKPSAEFLSASKSVARMVFTPKTGYTGYCSGT LLNNSNSPKRQLFWSAAHCISTQKVANTLQTYWLYDATGCDNDTLSDKAV TLTGGATLLHSHATRDTLLLELKSAPPSGAYYAGWNSSAIATKGTAIEGI HHPSGDLKKYSLGSVTALSSTIDGKKPLTKVAWTTGVTEGGSSGSGLFTI SSTSGYQLRGGLYGGTSYCSAPSDPDYYSQLDGVWSSIKTYFSPHHHHHH HH
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      220 to 463
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Lysobacter enzymogenes.
  • Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab245791 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

      HPLC

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      Sterile filtered through a 0.2 micron filter. Lyophilized from 50mM Tris, pH 8.0 + 10mM CaCl2.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Centrifuge vial prior to opening. For best results use only freshly reconstituted protease. Reconstitute in water to 0.1-1.0 mg/ml. Arg-C is activated by DTT, Cysteine, or other sulfhydryl containing reagents. The presence of calcium ions is essential. Arg-C is inhibited by oxidizing agents and sulfhydryl reactants and by Co2+, Cu2+, Cd2+, and heavy metal ions. Do not vortex. Store at 2°C to 8°C for 1 week, or prepare for extended storage.

    General Info

    • Relevance

      Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at, or adjacent to specific residues, or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes, including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Arg-C specifically cleaves at the carboxyl side of Arginine residues. Arg-C has a sulfhydryl requirement; it is activated by dithiothreitol, cysteine, or other sulfhydryl-containing reagents. The presence of calcium ions is essential. The enzyme is inhibited by oxidizing agents and sulfhydryl reactants, and by Co2+, Cu2+, Cd2+, and heavy metal ions.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab245791? Please let us know so that we can cite the reference in this datasheet.

    ab245791 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      Sterile filtered through a 0.2 micron filter. Lyophilized from 50mM Tris, pH 8.0 + 10mM CaCl2.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Centrifuge vial prior to opening. For best results use only freshly reconstituted protease. Reconstitute in water to 0.1-1.0 mg/ml. Arg-C is activated by DTT, Cysteine, or other sulfhydryl containing reagents. The presence of calcium ions is essential. Arg-C is inhibited by oxidizing agents and sulfhydryl reactants and by Co2+, Cu2+, Cd2+, and heavy metal ions. Do not vortex. Store at 2°C to 8°C for 1 week, or prepare for extended storage.

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-HEXIM2 antibody (ab234979)

    •  
    • Product image

      Cytokine Array – Mouse Cytokine Antibody Array (Membrane, 22 Targets) (ab133993)

    •  
    • Product image

      Anti-PLCZ1 antibody (ab181816)

    •  
    • Product image

      Recombinant Human Lymphotactin/ATAC protein (ab85406)

    •  
    • Product image

      Recombinant Human SPINK4 protein (His tag) (ab276421)

    •  
    • Product image

      Recombinant Staphylococcus aureus PDF protein (Tagged) (ab235870)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.