Recombinant dog GM-CSF protein (ab200292)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant dog GM-CSF protein
See all GM-CSF proteins and peptides -
Biological activity
The ED50 determined by a cell proliferation assay using Human TF-1 cells is less than 4 ng/mL, corresponding to a specific activity of >2.5 x 105 IU/mg.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Dog -
Sequence
APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPE GPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQN NFKSFKENLKDFLFNIPFDCWKPVKK -
Predicted molecular weight
14 kDa -
Amino acids
18 to 144 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.
Specifications
Our Abpromise guarantee covers the use of ab200292 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store under desiccating conditions.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 µM filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
General Info
-
Alternative names
- Colony stimulating factor
- Colony Stimulating Factor 2
- Colony stimulating factor 2 (granulocyte-macrophage)
see all -
Function
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. -
Sequence similarities
Belongs to the GM-CSF family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab200292 has not yet been referenced specifically in any publications.
Preparation and Storage
- Colony stimulating factor
- Colony Stimulating Factor 2
- Colony stimulating factor 2 (granulocyte-macrophage)