Recombinant Apoptin (VP3) protein (His tag) (ab237006)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant Apoptin (VP3) protein (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Sequence
MNALQEDTPPGPSTVFRPPTSSRPLETPHCEIRIGIAGITITLSLCGCAN ARAPTLRSATADSSESTGFKNAPDLRTDQPKPPSKKRSCDPSEYRVSELK ENLITTTPSRPRTARRCIRL -
Predicted molecular weight
17 kDa including tags -
Amino acids
1 to 120 -
Tags
His tag N-Terminus -
Additional sequence information
Chicken anemia virus (isolate USA 26p4) (CAV).
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Apoptin (VP3) protein (His tag) (ab237006)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab237006.
-
Mass Spectrometry - Recombinant Apoptin (VP3) protein (His tag) (ab237006)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237006 could indicate that this peptide derived from E.coli-expressed Chicken anemia virus (isolate USA 26p4) (CAV) VP3.
-
Mass Spectrometry - Recombinant Apoptin (VP3) protein (His tag) (ab237006)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237006 could indicate that this peptide derived from E.coli-expressed Chicken anemia virus (isolate USA 26p4) (CAV) VP3.
