ProTx-II, NaV1 channel blocker (ab141880)
Key features and details
- Potent, selective NaV1 channel blocker
- CAS Number:
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Thrixopelma pruriens
Overview
-
Product name
ProTx-II, NaV1 channel blocker -
Description
Potent, selective NaV1 channel blocker -
Biological description
Potent, selective NaV1 channel blocker (IC50 values are 0.3 and 30-150 nM for NaV1.7 and other NaV1 subtypes respectively). Acts as a gating modifier similar to ProTX-I (Asc 1863) and shifts the voltage dependence of activation to more depolarized potentials. Selectively blocks the C-fibre compound action potential in vivo. -
Purity
> 98% -
Chemical structure

Properties
-
Molecular weight
3832.60 -
Molecular formula
C168H256N46O41S8 -
Sequence
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW (Modifications: Disulfide bonds: 2-16, 9-21, 15-25) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Thrixopelma pruriens
-
Research areas